Logo
Information on 1klu_D_156
Loop code: 1klu_D_156
PDB: 1klu
Chain: D
Type: HE alpha-beta
Loop Start: 156  Loop Length: 11
Sec Struct Nt length: 16  Sec Struct Ct length: 7
Structure geometry
d (Å): 15.827200 delta (°): 107.580200theta (°): 144.465805 rho (°): 310.493988
Sequence:AQELDIKARNFLINKKNLYEFNSSPYETGYIKFI
Sec Struct:HHHHHHHHHHHHHHHH-SS-SS--S-SEEEEEEE