Logo
Information on 1f0c_A_299
Loop code: 1f0c_A_299
PDB: 1f0c
Chain: A
Type: HE alpha-beta
Loop Start: 299  Loop Length: 21
Sec Struct Nt length: 6  Sec Struct Ct length: 13
Structure geometry
d (Å): 22.195700 delta (°): 117.733002theta (°): 100.963799 rho (°): 281.455597
Sequence:LVDALVKLGLTEVFGSTGDYSNMCNSDVSVDAMIHKTYID
Sec Struct:HHHHHHTT--SSSSTT---TTTBSS--EEEEEEEEEEEEE