|
|
|
|
|
|
|
| Information on 1f99_B_113 |
|
Loop code: 1f99_B_113 PDB: 1f99 Chain: B Type: HH alpha-alpha |
Loop Start: 113 Loop Length: 3 Sec Struct Nt length: 8 Sec Struct Ct length: 19 Structure geometry
|
| Sequence: | LRETYQALGTPGASVAVAIQKMKDAALALV |
| Sec Struct: | HHHHHHHHT--HHHHHHHHHHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| CYCPHYCOCYANOBILIN | L - 113 | 1 | 0 |
| CYCPHYCOCYANOBILIN | T - 116 | 1 | 0 |
| CYCPHYCOCYANOBILIN | Y - 117 | 1 | 0 |
| CYCPHYCOCYANOBILIN | L - 120 | 0 | 1 |
| CYCPHYCOCYANOBILIN | T - 122 | 0 | 1 |
| CYCPHYCOCYANOBILIN | P - 123 | 0 | 1 |
| CYCPHYCOCYANOBILIN | S - 126 | 1 | 0 |
| CYCPHYCOCYANOBILIN | V - 127 | 1 | 0 |
| CYCPHYCOCYANOBILIN | A - 130 | 1 | 0 |
| PEBPHYCOERYTHROBILIN | V - 142 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|