Logo
Information on 1gh0_B_113
Loop code: 1gh0_B_113
PDB: 1gh0
Chain: B
Type: HH alpha-alpha
Loop Start: 113  Loop Length: 3
Sec Struct Nt length: 8  Sec Struct Ct length: 19
Structure geometry
d (Å): 10.543300 delta (°): 124.820702theta (°): 131.494598 rho (°): 42.445099
Sequence:LRETYLALGTPGSSVAVGVGKMKEAALAIV
Sec Struct:HHHHHHHHT--HHHHHHHHHHHHHHHHHHH
PDB ligands within a cut-off distance of 6 Å in this loop
LigandsResidueatSSatLOOP
CYCPHYCOCYANOBILIN L - 11310
CYCPHYCOCYANOBILIN T - 11610
CYCPHYCOCYANOBILIN Y - 11710
CYCPHYCOCYANOBILIN L - 12001
MENN-METHYL ASPARAGINE L - 12001
MENN-METHYL ASPARAGINE G - 12101
CYCPHYCOCYANOBILIN T - 12201
MENN-METHYL ASPARAGINE T - 12201
CYCPHYCOCYANOBILIN P - 12301
MENN-METHYL ASPARAGINE P - 12301
CYCPHYCOCYANOBILIN G - 12401
CYCPHYCOCYANOBILIN S - 12610
CYCPHYCOCYANOBILIN V - 12710
CYCPHYCOCYANOBILIN G - 13010
CYCPHYCOCYANOBILIN V - 14210