Logo
Information on 1kn1_B_21
Loop code: 1kn1_B_21
PDB: 1kn1
Chain: B
Type: HH alpha-alpha
Loop Start: 21  Loop Length: 1
Sec Struct Nt length: 26  Sec Struct Ct length: 12
Structure geometry
d (Å): 4.847100 delta (°): 36.200298theta (°): 66.946297 rho (°): 182.450394
Sequence:SSAIEKLKGYFQTGELRVRAATTIAANAANIIKEAVAKS
Sec Struct:HHHHHHHHHHHHHHHHHHHHHHHHHHTHHHHHHHHHHHH