Logo
Information on 1lq1_A_171
Loop code: 1lq1_A_171
PDB: 1lq1
Chain: A
Type: HH alpha-alpha
Loop Start: 171  Loop Length: 11
Sec Struct Nt length: 15  Sec Struct Ct length: 8
Structure geometry
d (Å): 13.076000 delta (°): 128.225906theta (°): 125.491600 rho (°): 346.913605
Sequence:KGYLYLREAISMVYNDIELLGSITKVLYPDIAKK
Sec Struct:HHHHHHHHHHHHHHH-GGGGG-TTTTHHHHHHHH