|
|
|
|
|
|
|
| Information on 1dow_A_209 |
|
Loop code: 1dow_A_209 PDB: 1dow Chain: A Type: HH alpha-alpha |
Loop Start: 209 Loop Length: 4 Sec Struct Nt length: 22 Sec Struct Ct length: 25 Structure geometry
|
| Sequence: | AARGILQKNVPILYTASQACLQHPDVAAYKANRDLIYKQLQQAVTGISNAA |
| Sec Struct: | HHHHHHHHHHHHHHHHHHHHHH-TT-HHHHHHHHHHHHHHHHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| MSESELENOMETHIONINE | A - 209 | 1 | 0 |
| MSESELENOMETHIONINE | A - 210 | 1 | 0 |
| MSESELENOMETHIONINE | R - 211 | 1 | 0 |
| MSESELENOMETHIONINE | G - 212 | 1 | 0 |
| MSESELENOMETHIONINE | G - 254 | 1 | 0 |
| MSESELENOMETHIONINE | I - 255 | 1 | 0 |
| MSESELENOMETHIONINE | A - 258 | 1 | 0 |
| MSESELENOMETHIONINE | A - 259 | 1 | 0 |
| Associated ArchDB95 Subclass to 1dow_A_209 |
| For any comment or web-related incidence, send an email to the webmaster. |
|