|
|
|
|
|
|
|
| Information on 1i4a_A_229 |
|
Loop code: 1i4a_A_229 PDB: 1i4a Chain: A Type: HH alpha-alpha |
Loop Start: 229 Loop Length: 6 Sec Struct Nt length: 29 Sec Struct Ct length: 11 Structure geometry
|
| Sequence: | GSFEDALLAIVKCMRNKSAYFAERLYKSMKGLGTDDDTLIRVMVSR |
| Sec Struct: | HHHHHHHHHHHHHHHHHHHHHHHHHHHHHSSSS--HHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| CACALCIUM ION | S - 256 | 0 | 1 |
| CACALCIUM ION | M - 257 | 0 | 1 |
| CACALCIUM ION | K - 258 | 0 | 1 |
| CACALCIUM ION | G - 259 | 0 | 1 |
| CACALCIUM ION | L - 260 | 0 | 1 |
| CACALCIUM ION | G - 261 | 0 | 1 |
| CACALCIUM ION | T - 262 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|