Logo
Information on 1ub2_A_602
Loop code: 1ub2_A_602
PDB: 1ub2
Chain: A
Type: HH alpha-alpha
Loop Start: 602  Loop Length: 22
Sec Struct Nt length: 13  Sec Struct Ct length: 6
Structure geometry
d (Å): 8.841400 delta (°): 114.330101theta (°): 107.321999 rho (°): 23.626801
Sequence:APEMTVLIGGLRVLGTNHGGTKHVVFTDREGVLTNDFFVNL
Sec Struct:HHHHHHHHHHHHHTT--GGG--TT---S-TTS--SHHHHHH