Logo
Information on 1q1s_C_223
Loop code: 1q1s_C_223
PDB: 1q1s
Chain: C
Type: HH alpha-alpha
Loop Start: 223  Loop Length: 9
Sec Struct Nt length: 14  Sec Struct Ct length: 14
Structure geometry
d (Å): 11.254000 delta (°): 49.593102theta (°): 151.390106 rho (°): 171.958893
Sequence:CGYLRNLTWTLSNLCRNKNPAPPLDAVEQILPTLVRL
Sec Struct:HHHHHHHHHHHHHHT---TT---HHHHHHHHHHHHHH