|
|
|
|
|
|
|
| Information on 1jwy_A_196 |
|
Loop code: 1jwy_A_196 PDB: 1jwy Chain: A Type: HH alpha-alpha |
Loop Start: 196 Loop Length: 4 Sec Struct Nt length: 15 Sec Struct Ct length: 17 Structure geometry
|
| Sequence: | KTENTKKVIQYLASVAGSGVLEQQILQANPILEAFG |
| Sec Struct: | HHHHHHHHHHHHHHH----HHHHHHHHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| ADPADENOSINE-5'-DIPHOSPHATE | K - 196 | 1 | 0 |
| MGMAGNESIUM ION | K - 196 | 1 | 0 |
| ADPADENOSINE-5'-DIPHOSPHATE | T - 197 | 1 | 0 |
| MGMAGNESIUM ION | T - 197 | 1 | 0 |
| ADPADENOSINE-5'-DIPHOSPHATE | E - 198 | 1 | 0 |
| MGMAGNESIUM ION | E - 198 | 1 | 0 |
| ADPADENOSINE-5'-DIPHOSPHATE | N - 199 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|