Logo
Information on 1jwy_A_301
Loop code: 1jwy_A_301
PDB: 1jwy
Chain: A
Type: HH alpha-alpha
Loop Start: 301  Loop Length: 23
Sec Struct Nt length: 7  Sec Struct Ct length: 15
Structure geometry
d (Å): 19.828501 delta (°): 128.047394theta (°): 80.423500 rho (°): 343.785797
Sequence:AEEKKALHLAGPESFNYLNQSGCVDIKGVSDSEEFKITRQAMDIV
Sec Struct:HHHHHHHT---GGG-TTTSSSS----TT--HHHHHHHHHHHHHHH