Logo
Information on 1v4s_A_15
Loop code: 1v4s_A_15
PDB: 1v4s
Chain: A
Type: HH alpha-alpha
Loop Start: 15  Loop Length: 6
Sec Struct Nt length: 6  Sec Struct Ct length: 19
Structure geometry
d (Å): 16.010500 delta (°): 44.227299theta (°): 22.334499 rho (°): 239.080902
Sequence:LVEQILAEFQLQEEDLKKVMRRMQKEMDRGL
Sec Struct:HHHHHHGGG---HHHHHHHHHHHHHHHHHHH