Information on SUBCLASS 2.4.4 |
Subclass Accession number: 149
Subclass: 2.4.4 Type: HE alpha-beta DB: ArchDB40 Image coordinates: Consensus coordinates: Conserved Annotation SCOP : 53849 (>75 %) 53850 (>75 %) 53851 (>75 %) |
Number of loops: 2 Average sequence ID (%) : 25.0 +/- 0.0 Average RMSD (Å) : 0.500 +/- 0.000 Consensus geometry
|
Consensus Sequence: | cpXhhh |
(φψ)-conformation: | aalabb |
Pattern: | [DE] | [T] | [Q] | [R] | [QS] | [AE] | [L] | [Y] | [AR] | [DK] | [AI] | [EL] | [QT] | [QR] | [L] | [DH] | [DK] | [DE] | [AS] | [AV] | [IY] | [LV] | [P] | [IV] | [SY] | [Y] | [IY] | [SV] | x | [AM] | x | [LV] |
Conservation: | 0.424 | 1.145 | 1.145 | 1.145 | -0.442 | -0.730 | 0.568 | 2.299 | -0.730 | -0.442 | -0.874 | -1.307 | -0.586 | -0.009 | 0.568 | -0.009 | -0.442 | 0.424 | -0.298 | -0.586 | -0.442 | -0.298 | 2.299 | 0.279 | -0.730 | 2.299 | -0.442 | -1.163 | -0.730 | -0.730 | -1.307 | -0.298 |
Loops included in this Subclass |
Loop | PDB | Chain | Start | End | Sequence | Sec Struct | Ramachandran |
1jet_A_459 | 1jet | A | 459 | 490 | DTQRSELYAKAEQQLDKDSAIVPVYYYVNARL | HHHHHHHHHHHHHHHHHTT-EEEEEEEEEEEE | aaaaaaaaaaaaaaaaaalabbwabxxbxbbb |
1uiu_A_444 | 1uiu | A | 444 | 475 | ETQRQALYRDILTRLHDEAVYLPISYISMMVV | HHHHHHHHHHHHHHHHHTT-EEEEEEEEEEEE | aaaaaaaaaaaaaaaaaalabbwabbxbxbbb |
PDB ligands within a cut-off distance of 6 Å in this subclass |
Loop | PDB | Chain | Ligands | Residue |
1jet_A_459 | 1jet | A | IUMURANYL (VI) ION | D - 459 |
1jet_A_459 | 1jet | A | IUMURANYL (VI) ION | R - 462 |
Clusters included in this Subclass |
CLUSTER: HE.4.178 |