Information on SUBCLASS 11.3.1 |
Subclass Accession number: 1579
Subclass: 11.3.1 Type: EH beta-alpha DB: ArchDB40 Image coordinates: Consensus coordinates: Conserved Annotation EC : 1.1 (>75 %) 1.1 (>75 %) 1.1.1 (>75 %) 1.1.1 (>75 %) 1.1.1.27 (>75 %) 1.1.1.273.4 (>75 %) 3.4.17 (>75 %) GO : GO:0004180 (>75 %) GO:0004457 (>75 %) GO:0004457 (>75 %) GO:0004459 (>75 %) GO:0004459 (>75 %) GO:0008233 (>75 %) GO:0008235 (>75 %) GO:0008237 (>75 %) GO:0008238 (>75 %) GO:0016614 (>75 %) GO:0016614 (>75 %) GO:0016616 (>75 %) GO:0016616 (>75 %) SCOP : 51734 (>75 %) 51734 (>75 %) 51735 (>75 %) 51735 (>75 %) 51848 (>75 %) 51848 (>75 %) 54861 (>50 %) 54897 (>50 %) 54898 (>50 %) |
Number of loops: 3 Average sequence ID (%) : 67.5 +/- -19.3 Average RMSD (Å) : 0.133 +/- 0.058 Consensus geometry
|
Consensus Sequence: | ELRDTGRYGFLLPXp |
(φψ)-conformation: | bppwagaaeaappaa |
Pattern: | [Y] | [S] | [F] | [AT] | [F] | [E] | [L] | [R] | [D] | [T] | [G] | [R] | [Y] | [G] | [F] | [L] | [L] | [P] | [AE] | [RS] | [Q] | [I] | x | [AP] | [T] | [AC] | [EQ] | [E] | [T] | [FW] | [L] | [AG] | [ILV] | [KL] | x | [IV] | [AM] | [ES] | [HY] | [TV] | x |
Conservation: | 1.654 | -0.008 | 1.100 | -0.895 | 1.100 | 0.546 | -0.008 | 0.546 | 1.100 | 0.546 | 1.100 | 0.546 | 1.654 | 1.100 | 1.100 | -0.008 | -0.008 | 1.654 | -1.266 | -1.257 | 0.546 | -0.008 | -1.792 | -0.874 | 0.546 | -0.545 | -0.263 | 0.546 | 0.546 | 0.570 | -0.008 | -0.768 | -0.746 | -1.441 | -1.731 | -0.282 | -1.210 | -0.936 | 0.452 | -0.989 | -1.915 |
Loops included in this Subclass |
Loop | PDB | Chain | Start | End | Sequence | Sec Struct | Ramachandran |
1aye_*_265 | 1aye | - | 265 | 305 | YSFAFELRDTGRYGFLLPARQILPTAEETWLGLKAIMEHVR | EEEEEEES-SSSSTTS--GGGHHHHHHHHHHHHHHHHHHHH | xbbbbbxpwaNaaeaaxwaaaaaaaaaaaaaaaaaaaaaaa |
1kwm_A_265 | 1kwm | A | 265 | 305 | YSFTFELRDTGRYGFLLPESQIRATCEETFLAIKYVASYVL | EEEEEEES-SSSSGGG--GGGHHHHHHHHHHHHHHHHHHHH | bbbbbbxxwagaaeaapxaaaaaaaaaaaaaaaaaaaaaaa |
1m4l_A_265 | 1m4l | A | 265 | 305 | YSFTFELRDTGRYGFLLPASQIIPTAQETWLGVLTIMEHTV | EEEEEEES-SSSSTTS--GGGHHHHHHHHHHHHHHHHHHHH | xbbbxbxpwagaaeaaxpaaaaaaaaaaaaaaaaaaaaaaa |
PDB ligands within a cut-off distance of 6 Å in this subclass |
Loop | PDB | Chain | Ligands | Residue |
1m4l_A_265 | 1m4l | A | ZNZINC ION | E - 270 |
PDB Site Annotated loops in this subclass |
Clusters included in this Subclass |
CLUSTER: EH.13.11 |