Information on SUBCLASS 2.3.12 |
Subclass Accession number: 2230
Subclass: 2.3.12 ![]() Type: HH alpha-alpha DB: ArchDB40 Image coordinates: ![]() ![]() Consensus coordinates: ![]() ![]() Conserved Annotation EC : 4.2 (>50 %) 4.2.2 (>50 %) 4.2.2.1 GO : GO:0003723 (>75 %) GO:0004518 (>75 %) GO:0004519 (>75 %) GO:0004540 (>75 %) GO:0016788 (>75 %) GO:0016829 (>50 %) GO:0016835 (>50 %) GO:0016837 (>50 %) GO:0030340 (>50 %) SCOP : 48207 (>50 %) 48230 (>50 %) 48234 (>50 %) 48370 (>75 %) 55894 (>75 %) 55895 (>75 %) 55896 (>75 %) |
Number of loops: 3 Average sequence ID (%) : 44.8 +/- 11.8 Average RMSD (Å) : 0.400 +/- 0.100 Consensus geometry
|
Consensus Sequence: | pXhcQX |
(φψ)-conformation: | aabpaa |
Pattern: | [APQ] | x | [W] | [KS] | [HY] | [EQ] | [WY] | x | [K] | [H] | [G] | [ST] | [C] | [ACS] | [EQ] | [KNS] | x | [FY] | [DN] | [Q] | x | [AGT] | [Y] | [F] | [GK] | [KL] | [A] | [LV] | [DR] | [LM] | [KR] | [DN] |
Conservation: | -1.054 | -0.799 | 2.864 | -0.611 | 0.449 | -0.092 | 0.851 | -1.318 | 0.487 | 1.675 | 0.883 | -0.354 | 2.072 | -0.746 | -0.092 | -0.746 | -1.230 | 0.374 | -0.043 | 0.487 | -0.966 | -1.010 | 1.279 | 0.883 | -0.794 | -0.966 | 0.091 | -0.468 | -0.729 | -0.225 | -0.072 | -0.081 |
Loops included in this Subclass |
Loop | PDB | Chain | Start | End | Sequence | Sec Struct | Ramachandran |
1ioo_A_82 | 1ioo | A | 82 | 113 | PSWKYQYIKHGSCCQKRYNQNTYFGLALRLKD | HHHHHHHHHTGGG-TTT--HHHHHHHHHHHHH | aaaaaaaaaaaaaaaaabbaaaaaaaaaaaaa |
1iyb_A_87 | 1iyb | A | 88 | 119 | AFWSHEWEKHGTCAENVFDQHGYFKKALDLKN | HHHHHHHHHTGGGGTTT--HHHHHHHHHHHHH | aaaaaaaaaaaaaaaaabxaaaaaaaaaaaaa |
1uca_A_77 | 1uca | A | 79 | 110 | QFWSHEWTKHGTCSESTFNQAAYFKLAVDMRN | HHHHHHHHHTGGGGTTT--HHHHHHHHHHHHH | aaaaaaaaaaaaaaaaabxaaaaaaaaaaaaa |
PDB ligands within a cut-off distance of 6 Å in this subclass |
Clusters included in this Subclass |
CLUSTER: HH.9.24 |