ArchDB - Biological DataBase of Protein Loops

Information on SUBCLASS 7.45.1

Subclass Accession number: 3465
Subclass: 7.45.1

Type: EH beta-alpha
DB: ArchDB95

Image coordinates:

Consensus coordinates:

Conserved Annotation
EC : 1.1 (>75 %)  1.1.1 (>75 %)  1.1.1.37
GO : GO:0016614 (>75 %)  GO:0016615 (>75 %)  GO:0016616 (>75 %)  GO:0030060 (>75 %)
SCOP : 56326 (>75 %)  56327 (>75 %)  56328 (>75 %)

Number of loops: 3

Average sequence ID (%) : 43.8 +/- 10.6
Average RMSD (Å) : 0.300 +/- 0.000

Consensus geometry

d (Å): 21

delta (°): 0-45

theta (°): 90-135

rho (°): 135-180

Consensus Sequence:	phVpGLXIcXF
(φψ)-conformation:	bppblppbpaa

Pattern:	[AET]	[WY]	[KR]	[IV]	[V]	[EQ]	[G]	[L]	[EPS]	[I]	[DN]	[ADE]	[F]	[AS]	[QR]	[EK]	[KR]	[IM]	[DEN]	[ILV]	[T]	[AL]	[KNQ]	[E]	[L]	[AL]	[DE]	[E]	[KMQ]	[EN]	[GQT]	[AV]
Conservation:	-1.497	1.419	0.251	0.215	0.551	0.247	1.970	0.551	-1.340	0.551	0.280	-1.261	1.970	-0.458	-0.091	-0.085	0.256	-0.200	-0.473	-0.394	1.260	-1.138	-0.867	1.260	0.551	-1.123	0.357	1.260	-1.103	-0.320	-1.812	-0.788

Loops included in this Subclass

Loop	PDB	Chain	Start	End	Sequence	Sec Struct	Ramachandran
1b8p_A_293	1b8p	A	293	324	EYKIVQGLSIDAFSQERINVTLNELLEEQNGV	EEEE-------HHHHHHHHHHHHHHHHHHHHH	bbbxxbvxxbxaaaaaaaaaaaaaaaaaaaaa
1iz9_A_290	1iz9	A	290	321	AYRVVEGLEINEFARKRMEITAQELLDEMEQV	EEEE-------HHHHHHHHHHHHHHHHHHHHH	bbbxxbvxxbxaaaaaaaaaaaaaaaaaaaaa
4mdh_A_295	4mdh	A	295	326	TWKIVEGLPINDFSREKMDLTAKELAEEKETA	EEEE-------HHHHHHHHHHHHHHHHHHHHH	bxbxxbvxpbxaaaaaaaaaaaaaaaaaaaaa

Clusters included in this Subclass