Logo
Information on SUBCLASS 12.7.1
Subclass Accession number: 3584
Subclass: 12.7.1 PSSM
Type: EH beta-alpha
DB: ArchDB95

Image coordinates: Rasmol PDB Jmol PDB
Consensus coordinates: Rasmol PDB Jmol PDB

Conserved Annotation
EC : 2.7.2 (>75 %)  2.7.2.33.2 (>75 %)  3.2.1 (>75 %)  3.2.1.8 (>75 %)  
GO : GO:0004553 (>75 %)  GO:0004618 (>75 %)  GO:0016301 (>75 %)  GO:0016772 (>75 %)  GO:0016774 (>75 %)  GO:0016798 (>75 %)  
SCOP : 51445 (>75 %)  51487 (>75 %)  53747 (>75 %)  53748 (>75 %)  53749 (>75 %)  
 Number of loops: 4

Average sequence ID (%) : 55.1 +/- 18.5
Average RMSD (Å) : 0.475 +/- 0.096

Consensus geometry
d (Å): 15 delta (°): 45-90 theta (°): 90-135 rho (°): 90-135
Consensus Sequence: VNEhhcpDhphRcSXh
(φψ)-conformation: bblabpaalpppapaa
Pattern: [AY][W][D][V][LV][N][E][AIV][FV][GN][DE][D][GL][KS][LM][R][DNQ][ST]x[FW][LY][KNQ][IV]
Conservation:-0.8753.2591.0560.175-0.4301.0560.616-0.872-0.720-0.2640.0741.056-1.127-0.587-0.1760.616-0.599-0.377-1.3860.547-0.300-0.697-0.045
Loops included in this Subclass
LoopPDBChainStartEndSequenceSec StructRamachandran
1bg4_*_1261bg4   -126148AWDVLNEIFNEDGSLRNSVFYNVEEEEEES-B-TTSSB---HHHHHbbxabblabxaavxxxxxaaaaa
1hiz_A_1541hiz   A154176YWDVVNEVVGDDGKLRNSPWYQIEEEEEES-B-TTSSB---HHHHHbbxabblabxaavbpxaxaaaaa
1i1w_A_1251i1w   A125147AWDVVNEAFNEDGSLRQTVFLNVEEEEEES-B-TTSSB---HHHHHbbxabblabxaavxxxxxaaaaa
1ur1_A_1511ur1   A151173AWDVVNEAVGDDLKMRDSHWYKIEEEEEE--B-TTSSB---HHHHHbbxabbvabxaavxpxaxaaaaa
PDB ligands within a cut-off distance of 6 Å in this subclass
LoopPDBChainLigandsResidue
1bg4_*_1261bg4   *     GOLGLYCEROL N - 131
1bg4_*_1261bg4   *     GOLGLYCEROL E - 132
1hiz_A_1541hiz   A     GLCGLUCOSE N - 159
1hiz_A_1541hiz   A     GLCGLUCOSE E - 160
1hiz_A_1541hiz   A     GLCGLUCOSE D - 164
1i1w_A_1251i1w   A     GOLGLYCEROL N - 130
1i1w_A_1251i1w   A     GOLGLYCEROL E - 131
1i1w_A_1251i1w   A     EOHETHANOL N - 134
1i1w_A_1251i1w   A     EOHETHANOL G - 137
1i1w_A_1251i1w   A     EOHETHANOL S - 138
1i1w_A_1251i1w   A     EOHETHANOL L - 139
1i1w_A_1251i1w   A     EOHETHANOL R - 140
1i1w_A_1251i1w   A     UNXUNKNOWN ATOM OR ION L - 145
1i1w_A_1251i1w   A     EOHETHANOL L - 145
1ur1_A_1511ur1   A     XYSXYLOPYRANOSE D - 153
1ur1_A_1511ur1   A     XYSXYLOPYRANOSE N - 156
1ur1_A_1511ur1   A     XYSXYLOPYRANOSE E - 157
PDB Site Annotated loops in this subclass
LoopPDBChainSiteResidue
1bg4_*_1261bg4   * ACTACTIVE SITE.E - 132
1ur1_A_1511ur1   A ACBCATALYTIC ACID BASEE - 157

Clusters included in this Subclass
CLUSTER: EH.11.25