Information on SUBCLASS 21.2.1 |
Subclass Accession number: 3631
Subclass: 21.2.1 ![]() Type: EH beta-alpha DB: ArchDB95 Image coordinates: ![]() ![]() Consensus coordinates: ![]() ![]() Conserved Annotation EC : 1.11 (>50 %) 1.11.1 (>50 %) 1.11.1.5 GO : GO:0004130 (>50 %) GO:0004601 (>75 %) GO:0016684 (>75 %) SCOP : 46625 (>75 %) 46626 (>75 %) 46685 (>75 %) |
Number of loops: 3 Average sequence ID (%) : 60.2 +/- -6.7 Average RMSD (Å) : 0.300 +/- 0.100 Consensus geometry
|
Consensus Sequence: | FphXXLRNhXLThPYFHpGXhhpLp |
(φψ)-conformation: | bppppaplaaaapwbeaalababaa |
Pattern: | [V] | [F] | [KR] | [AV] | [APS] | [PT] | [L] | [R] | [N] | [IV] | [AE] | [L] | [T] | [AY] | [P] | [Y] | [F] | [H] | [DS] | [G] | [AGQ] | [AV] | [AW] | [EST] | [L] | [EK] | [DEQ] | [A] | [V] | [AE] | [ITV] |
Conservation: | 0.139 | 1.195 | -0.114 | -0.902 | -1.209 | -0.565 | 0.139 | 0.667 | 1.195 | -0.116 | -0.955 | 0.139 | 0.667 | -1.114 | 1.723 | 1.723 | 1.195 | 2.251 | -0.696 | 1.195 | -1.444 | -0.902 | -0.529 | -1.151 | 0.139 | -0.355 | -0.564 | 0.139 | 0.139 | -1.059 | -0.975 |
Loops included in this Subclass |
Loop | PDB | Chain | Start | End | Sequence | Sec Struct | Ramachandran |
1eb7_A_243 | 1eb7 | A | 244 | 274 | VFRAAPLRNVALTAPYFHSGQVWELKDAVAI | EEE----TTGGGS-SBTTTT-B--HHHHHHH | bbxxpxapvaaaaxwbeaavababaaaaaaa |
1iqc_A_227 | 1iqc | A | 227 | 257 | VFKVPTLRNIELTYPYFHDGGAATLEQAVET | EEE----TTGGGS-SBSTT--B-SHHHHHHH | bbxxxxaxvaaaaxwbeaavababaaaaaaa |
1nml_A_243 | 1nml | A | 244 | 274 | VFRASPLRNIELTAPYFHSGAVWSLEEAVAV | EEE----TTGGG--SBTTT--B--HHHHHHH | bbxxpxapvaaaaxwbeaavabaxaaaaaaa |
PDB ligands within a cut-off distance of 6 Å in this subclass |
PDB Site Annotated loops in this subclass |
Clusters included in this Subclass |
CLUSTER: EH.20.3 |