Information on SUBCLASS 9.2.1 |
Subclass Accession number: 456
Subclass: 9.2.1 Type: HE alpha-beta DB: ArchDB40 Image coordinates: Consensus coordinates: Conserved Annotation EC : 3.1 (>75 %) 3.1.1 (>75 %) 3.2 (>75 %) 3.2 (>75 %) 3.2.1 (>75 %) 3.2.1 (>75 %) 3.2.1.113 (>75 %) 3.2.1.113 GO : GO:0004091 (>75 %) GO:0004553 (>75 %) GO:0004553 (>75 %) GO:0005509 (>75 %) GO:0005509 (>75 %) GO:0015923 (>75 %) GO:0015923 (>75 %) GO:0016788 (>75 %) GO:0016789 (>75 %) GO:0016798 (>75 %) GO:0016798 (>75 %) SCOP : 48207 (>75 %) 48207 (>75 %) 48225 (>75 %) 48225 (>75 %) 48226 (>75 %) 48226 (>75 %) 53473 (>75 %) 53474 (>75 %) 53475 (>75 %) |
Number of loops: 3 Average sequence ID (%) : 37.8 +/- 14.8 Average RMSD (Å) : 0.433 +/- 0.208 Consensus geometry
|
Consensus Sequence: | AFpTPSchPhXXh |
(φψ)-conformation: | aapbaagpppabb |
Pattern: | [DES] | [GIL] | [FL] | x | [DKR] | [KQ] | [AS] | x | [DEN] | [FL] | [AG] | [DNV] | x | [L] | [KLM] | [FP] | [A] | [F] | [DHR] | [T] | [P] | [S] | [GK] | [IV] | [P] | [WY] | [ANS] | x | [ILV] | [N] |
Conservation: | -0.397 | -1.372 | -0.024 | -0.796 | -0.684 | 0.110 | -0.160 | -1.257 | -0.168 | -0.244 | -0.024 | -1.143 | -1.028 | 0.577 | -0.799 | -0.658 | 0.577 | 1.609 | -0.741 | 1.093 | 2.125 | 0.577 | -0.388 | 0.331 | 2.125 | 1.205 | -0.684 | -1.257 | -0.111 | 1.609 |
Loops included in this Subclass |
Loop | PDB | Chain | Start | End | Sequence | Sec Struct | Ramachandran |
1fo3_A_349 | 1fo3 | A | 349 | 378 | SLFLRKAEDFGNRLMPAFRTPSKIPYSDVN | HHHHHHHHHHHHHHGGGG-SSS----SEEE | aaaaaaaaaaaaaaaaaaxbaavxxxabbx |
1kre_A_149 | 1kre | A | 153 | 182 | DGLLDQSRNLADVLKFAFDTPSGVPYNNIN | HHHHHHHHHHHHHHGGGG-SSSS---SEEE | aaaaaaaaaaaaaaaaaaxbaagxxxabbb |
1nxc_A_301 | 1nxc | A | 301 | 330 | EIFRKKAVELGVKLLPAFHTPSGIPWALLN | HHHHHHHHHHHHHHGGGG-SSSS---SEEE | aaaaaaaaaaaaaaawaaxbaavxxxabbx |
PDB ligands within a cut-off distance of 6 Å in this subclass |
Loop | PDB | Chain | Ligands | Residue |
1kre_A_149 | 1kre | A | NAGN-ACETYL-D-GLUCOSAMINE | N - 182 |
Clusters included in this Subclass |
CLUSTER: HE.12.3 |