Information on SUBCLASS 6.40.1 |
Subclass Accession number: 4983
Subclass: 6.40.1 ![]() Type: HH alpha-alpha DB: ArchDB95 Image coordinates: ![]() ![]() Consensus coordinates: ![]() ![]() Conserved Annotation EC : 3 (>50 %) SCOP : 46457 (>50 %) 46458 (>50 %) 46463 (>50 %) |
Number of loops: 3 Average sequence ID (%) : 21.1 +/- 22.4 Average RMSD (Å) : 1.100 +/- 0.458 Consensus geometry
|
Consensus Sequence: | hXXhhpXThX |
(φψ)-conformation: | aabaaaapaa |
Pattern: | x | [LT] | [AS] | [HQ] | x | [ILT] | x | [LV] | [ATV] | [ILM] | x | [AM] | [HLY] | x | [GP] | [AGY] | [DEY] | [FR] | [T] | [IP] | [AER] | [GV] | [FH] | [AEL] | [SV] | [LV] | [DV] | [EK] | [FK] | [EL] |
Conservation: | -0.904 | 0.006 | 0.795 | 1.807 | -1.106 | -0.298 | -0.803 | 0.795 | -0.298 | 0.712 | -0.803 | 0.366 | -0.096 | -1.409 | 0.738 | -0.904 | -0.399 | -0.171 | 2.934 | 0.036 | -0.601 | -0.721 | 1.512 | -1.308 | -0.561 | 0.809 | -0.306 | 1.210 | -0.171 | -0.856 |
Loops included in this Subclass |
Loop | PDB | Chain | Start | End | Sequence | Sec Struct | Ramachandran |
1ird_A_96 | 1ird | A | 100 | 129 | LLSHCLLVTLAAHLPAEFTPAVHASLDKFL | HHHHHHHHHHHHH-TTT--HHHHHHHHHHH | aaaaaaaaaaaaabaaaaxaaaaaaaaaaa |
1lw3_A_423 | 1lw3 | A | 423 | 452 | RTAQLTSLAMLMLDGYYRTIRGFEVLVEKE | HHHHHHHHHHHHH-GGGGSHHHHHHHHHHH | aaaaaaaaaaaaabaaaaxaaaaaaaaaaa |
1spg_A_98 | 1spg | A | 102 | 131 | ILAHNIILVISMYFPGDFTPEVHLSVDKFL | HHHHHHHHHHHHHSTTT--HHHHHHHHHHH | aaaaaaaaaaaaabaaaaxaaaaaaaaaaa |
PDB ligands within a cut-off distance of 6 Å in this subclass |
Clusters included in this Subclass |
CLUSTER: HH.7.71 |