Information on SUBCLASS 6.58.1 |
Subclass Accession number: 5001
Subclass: 6.58.1 Type: HH alpha-alpha DB: ArchDB95 Image coordinates: Consensus coordinates: Conserved Annotation EC : 3.1 (>50 %) 3.1.4 (>50 %) 3.1.4.3 GO : GO:0005509 (>75 %) GO:0008081 (>75 %) GO:0008270 (>75 %) GO:0016298 (>75 %) GO:0016788 (>75 %) GO:0016789 (>75 %) GO:0042578 (>75 %) GO:0046914 (>75 %) SCOP : 48536 (>75 %) 48537 (>75 %) 48538 (>75 %) |
Number of loops: 3 Average sequence ID (%) : 61.8 +/- -8.7 Average RMSD (Å) : 0.300 +/- 0.000 Consensus geometry
|
Consensus Sequence: | pDLSpcEPEX |
(φψ)-conformation: | aappaapwaa |
Pattern: | [T] | [H] | [AS] | [MV] | [I] | [AV] | [T] | [Q] | [AG] | [IV] | [EST] | [IM] | [L] | [EK] | [HN] | [D] | [L] | [S] | [KS] | [DN] | [E] | [P] | [E] | [ASV] | [IV] | [R] | [KN] | [DN] | [L] | [ES] | [I] | [L] | [EK] | [EKQ] |
Conservation: | 0.834 | 2.895 | -0.874 | -0.667 | 0.147 | -1.174 | 0.834 | 0.834 | -0.801 | -0.193 | -1.532 | -0.733 | 0.147 | -0.527 | 0.100 | 1.521 | 0.147 | 0.147 | -0.928 | -0.180 | 0.834 | 2.208 | 0.834 | -1.837 | -0.183 | 0.834 | -0.571 | -0.180 | 0.147 | -1.008 | 0.147 | 0.147 | -0.527 | -0.845 |
Loops included in this Subclass |
Loop | PDB | Chain | Start | End | Sequence | Sec Struct | Ramachandran |
1ca1_*_10 | 1ca1 | - | 10 | 43 | THAMIVTQGVSILENDLSKNEPESVRKNLEILKE | HHHHHHHHHHHHHHHH--TTS-HHHHHHHHHHHH | aaaaaaaaaaaaaaaapxaaxwaaaaaaaaaaaa |
1kho_A_10 | 1kho | A | 10 | 43 | THAMIATQGVTILENDLSSNEPEVIRNNLEILKQ | HHHHHHHHHHHHHHHH--TTS-HHHHHHHHHHHH | aaaaaaaaaaaaaaaaxxaaxwaaaaaaaaaaaa |
1olp_A_10 | 1olp | A | 10 | 43 | THSVIVTQAIEMLKHDLSKDEPEAIRNDLSILEK | HHHHHHHHHHHHHHHH--TTS-HHHHHHHHHHHH | aaaaaaaaaaaaaaaapxaaxxaaaaaaaaaaaa |
PDB ligands within a cut-off distance of 6 Å in this subclass |
Loop | PDB | Chain | Ligands | Residue |
1ca1_*_10 | 1ca1 | * | ZNZINC ION | H - 11 |
1ca1_*_10 | 1ca1 | * | CDCADMIUM ION | H - 11 |
1ca1_*_10 | 1ca1 | * | CDCADMIUM ION | P - 31 |
1ca1_*_10 | 1ca1 | * | CDCADMIUM ION | V - 34 |
PDB Site Annotated loops in this subclass |
Loop | PDB | Chain | Site | Residue |
1olp_A_10 | 1olp | A | AC9ZN BINDING SITE FOR CHAIN A | H - 11 |
Clusters included in this Subclass |
CLUSTER: HH.5.231 |