Information on SUBCLASS 8.21.1 |
Subclass Accession number: 5050
Subclass: 8.21.1 ![]() Type: HH alpha-alpha DB: ArchDB95 Image coordinates: ![]() ![]() Consensus coordinates: ![]() ![]() Conserved Annotation EC : 4.1 (>50 %) 4.1.99 (>50 %) GO : GO:0016829 (>75 %) GO:0016830 (>75 %) GO:0050371 (>50 %) SCOP : 53382 (>75 %) 53383 (>75 %) 53397 (>75 %) |
Number of loops: 3 Average sequence ID (%) : 72.0 +/- -27.1 Average RMSD (Å) : 0.300 +/- 0.100 Consensus geometry
|
Consensus Sequence: | hXGDEAYAGSpN |
(φψ)-conformation: | aappapablpaa |
Pattern: | [D] | [HK] | [Q] | [W] | [A] | [AG] | [M] | [IM] | [IMT] | [G] | [D] | [E] | [A] | [Y] | [A] | [G] | [S] | [ER] | [N] | [FY] | [Y] | [DH] | [L] | [EK] | [DKR] | [KT] | [AV] | [KQ] | [E] | [L] | [F] |
Conservation: | 0.795 | -0.847 | 0.300 | 3.274 | -0.196 | -0.913 | 0.300 | -0.802 | -1.518 | 0.795 | 0.795 | 0.300 | -0.196 | 1.291 | -0.196 | 0.795 | -0.196 | -0.937 | 0.795 | 0.166 | 1.291 | -0.664 | -0.196 | -0.690 | -1.408 | -1.184 | -1.185 | -0.668 | 0.300 | -0.196 | 0.795 |
Loops included in this Subclass |
Loop | PDB | Chain | Start | End | Sequence | Sec Struct | Ramachandran |
1ax4_A_59 | 1ax4 | A | 59 | 89 | DHQWAAMITGDEAYAGSRNYYDLKDKAKELF | HHHHHHHHT----SSS-HHHHHHHHHHHHHH | aaaaaaaaaxxapabvpaaaaaaaaaaaaaa |
1c7g_A_58 | 1c7g | A | 58 | 88 | DKQWAGMMIGDEAYAGSENFYHLEKTVKELF | HHHHHHTTS----SSS-HHHHHHHHHHHHHH | aaaaaaaaaxxaxabvxaaaaaaaaaaaaaa |
1tpl_A_58 | 1tpl | A | 58 | 88 | DKQWAGMMMGDEAYAGSENFYHLERTVQELF | HHHHHHHTT----SSS-HHHHHHHHHHHHHH | aaaaaaaaaxbaxabvpaaaaaaaaaaaaaa |
PDB ligands within a cut-off distance of 6 Å in this subclass |
Loop | PDB | Chain | Ligands | Residue |
1ax4_A_59 | 1ax4 | A | LLP2-LYSINE(3-HYDROXY-2-METHYL-5-PHOSPHONOOXYMETHYL-PYRIDIN-4-YLMETHANE) | Y - 72 |
1c7g_A_58 | 1c7g | A | PLPPYRIDOXAL-5'-PHOSPHATE | Y - 71 |
PDB Site Annotated loops in this subclass |
Loop | PDB | Chain | Site | Residue |
1ax4_A_59 | 1ax4 | A | POAPOTASSIUM BINDING SITE. | E - 70 |
1ax4_A_59 | 1ax4 | A | LPBPYRIDOXAL 5-PHOSPHATE BINDING SITE. | Y - 72 |
Clusters included in this Subclass |
CLUSTER: HH.10.49 |