Information on SUBCLASS 8.29.1 |
Subclass Accession number: 5058
Subclass: 8.29.1 ![]() Type: HH alpha-alpha DB: ArchDB95 Image coordinates: ![]() ![]() Consensus coordinates: ![]() ![]() |
Number of loops: 3 Average sequence ID (%) : 8.6 +/- 9.0 Average RMSD (Å) : 1.067 +/- 0.379 Consensus geometry
|
Consensus Sequence: | XhXXpXhpIXXX |
(φψ)-conformation: | aabpaapppbaa |
Pattern: | x | [AER] | [AGN] | [FMV] | [AV] | [HQR] | [AIL] | [CMV] | [HK] | [AGN] | [AFL] | [FIT] | [NP] | [DEQ] | [GNT] | [AFG] | [KT] | [I] | [ADT] | [ADK] | x | [AM] | x | [AEN] | [ACS] | x | [QWY] | [EQT] | [CTY] | [ALV] | x |
Conservation: | -1.636 | -0.469 | -0.210 | 0.179 | 0.822 | 0.827 | -0.210 | 0.309 | 1.333 | -0.210 | -0.729 | -0.599 | 1.562 | 1.346 | -0.080 | -0.988 | 0.931 | 2.902 | -0.599 | -0.858 | -1.377 | 0.421 | -1.247 | -0.599 | 0.438 | -1.247 | 0.957 | 0.179 | -0.340 | -0.210 | -0.599 |
Loops included in this Subclass |
Loop | PDB | Chain | Start | End | Sequence | Sec Struct | Ramachandran |
1j1i_A_160 | 1j1i | A | 160 | 190 | REGMVHLVKALTNDGFKIDDAMINSRYTYAT | HHHHHHHHHHHS-TT----HHHHHHHHHHHH | aaaaaaaaaaabxaaxxxbaaaaaaaaaaaa |
1n1j_A_59 | 1n1j | A | 59 | 89 | IANVARIMKNAIPQTGKIAKDAKECVQECVS | HHHHHHHHHHTS-TT----HHHHHHHHHHHH | aaaaaaaaaaabwaaxbbxaaaaaaaaaaaa |
1qo0_A_263 | 1qo0 | A | 265 | 295 | SRAFVQACHGFFPENATITAWAEAAYWQTLL | HHHHHHHHHHHS-TT----HHHHHHHHHHHH | aaaaaaaaaaaxxaabxxbaaaaaaaaaaaa |
PDB ligands within a cut-off distance of 6 Å in this subclass |
Loop | PDB | Chain | Ligands | Residue |
1qo0_A_263 | 1qo0 | A | BMDBUTYRAMIDE | W - 285 |
Clusters included in this Subclass |
CLUSTER: HH.8.67 |