Information on SUBCLASS 10.10.1 |
Subclass Accession number: 5107
Subclass: 10.10.1 ![]() Type: HH alpha-alpha DB: ArchDB95 Image coordinates: ![]() ![]() Consensus coordinates: ![]() ![]() Conserved Annotation EC : 1.9 (>75 %) 1.9.3 (>75 %) 1.9.3.1 GO : GO:0004129 (>50 %) GO:0004857 (>75 %) GO:0004859 (>75 %) GO:0005386 (>50 %) GO:0005509 (>75 %) GO:0005543 (>75 %) GO:0005544 (>75 %) GO:0008289 (>75 %) GO:0008324 (>50 %) GO:0015002 (>50 %) GO:0015075 (>50 %) GO:0015077 (>50 %) GO:0015078 (>50 %) GO:0015399 (>50 %) GO:0016675 (>50 %) GO:0016676 (>50 %) GO:0019834 (>75 %) SCOP : 47873 (>75 %) 47874 (>75 %) 47875 (>75 %) 81441 (>75 %) 81442 (>75 %) 81443 (>75 %) |
Number of loops: 4 Average sequence ID (%) : 56.0 +/- 20.0 Average RMSD (Å) : 0.625 +/- 0.126 Consensus geometry
|
Consensus Sequence: | XXGXRpEpXXhcpX |
(φψ)-conformation: | aalappapapbpaa |
Pattern: | [fg] | x | [fy] | [qr] | [kr] | [av] | [l] | [lv] | [st] | [l] | [as] | [adk] | [g] | [dgr] | [r] | [ds] | [e] | [ds] | x | x | [ilv] | [dn] | [de] | x | [l] | [am] | [dkr] | [qt] | [d] | [a] | [qr] | x | [l] | [y] | [ek] | [a] |
Conservation: | -0.823 | -0.921 | 1.034 | 0.051 | 0.324 | -0.577 | 0.593 | -0.285 | -0.181 | 0.593 | -0.285 | -1.369 | 1.811 | -1.369 | 1.202 | -0.118 | 1.202 | -0.381 | -1.259 | -1.436 | -0.219 | 0.359 | 0.570 | -1.301 | 0.593 | -0.772 | -0.895 | -0.540 | 1.811 | 0.593 | 0.041 | -1.707 | 0.593 | 2.420 | 0.051 | 0.593 |
Loops included in this Subclass |
Loop | PDB | Chain | Start | End | Sequence | Sec Struct | Ramachandran |
1axn_*_151 | 1axn | - | 151 | 186 | GDFRKALLTLADGRRDESLKVDEHLAKQDAQILYKA | HHHHHHHHHHHTT-S---S---HHHHHHHHHHHHHH | eaaaaaaaaaaalapxapaxbbaaaaaaaaaaaaaa |
1hm6_A_174 | 1hm6 | A | 174 | 209 | GDYQKALLSLAKGDRSEDLAINDDLADTDARALYEA | HHHHHHHHHHHTT------S--HHHHHHHHHHHHHH | eaaaaaaaaaaalaxpaxaxxxaaaaaaaaaaaaaa |
1i4a_A_145 | 1i4a | A | 145 | 180 | FMFQRVLVSLSAGGRDESNYLDDALMRQDAQDLYEA | HHHHHHHHHHHTT-S--S----HHHHHHHHHHHHHH | eaaaaaaaaaaalappaxaxbxaaaaaaaaaaaaaa |
1mcx_A_174 | 1mcx | A | 174 | 209 | GDYQKALLSLAKGDRSEDLAINDDLADTDARALYEA | HHHHHHHHHHHT------SS--HHHHHHHHHHHHHH | eaaaaaaaaaaalaxpaxaxxxaaaaaaaaaaaaaa |
PDB ligands within a cut-off distance of 6 Å in this subclass |
Loop | PDB | Chain | Ligands | Residue |
1axn_*_151 | 1axn | * | CACALCIUM ION | D - 152 |
1axn_*_151 | 1axn | * | CACALCIUM ION | A - 186 |
1mcx_A_174 | 1mcx | A | CACALCIUM ION | A - 209 |
Clusters included in this Subclass |
CLUSTER: HH.10.40 |