Information on SUBCLASS 10.15.1 |
Subclass Accession number: 5112
Subclass: 10.15.1 ![]() Type: HH alpha-alpha DB: ArchDB95 Image coordinates: ![]() ![]() Consensus coordinates: ![]() ![]() Conserved Annotation EC : 2.3 (>50 %) 2.3.1 (>50 %) 2.3.1.97 GO : GO:0000287 (>75 %) GO:0004872 (>75 %) GO:0005515 (>75 %) GO:0005518 (>50 %) GO:0008415 (>50 %) GO:0016746 (>50 %) GO:0016747 (>50 %) SCOP : 53299 (>75 %) 53300 (>75 %) 53301 (>75 %) 55728 (>50 %) 55729 (>50 %) 55748 (>50 %) |
Number of loops: 3 Average sequence ID (%) : 53.3 +/- 5.3 Average RMSD (Å) : 0.300 +/- 0.000 Consensus geometry
|
Consensus Sequence: | ppXXppGGXXTXTh |
(φψ)-conformation: | aapbpaeeabbpaa |
Pattern: | [KT] | [E] | [E] | [MV] | [IL] | [V] | [A] | [AT] | [KNS] | [KQ] | [IT] | [GSV] | [QR] | [QRY] | [G] | [G] | x | x | [T] | x | [T] | [AF] | [GL] | [AG] | [IT] | [DQ] | [TY] | [A] | [R] | [K] |
Conservation: | -0.564 | 1.181 | 1.181 | -0.157 | 0.013 | 0.594 | 0.594 | -0.448 | -0.644 | 0.018 | -0.739 | -1.492 | 0.074 | -0.905 | 1.768 | 1.768 | -1.818 | -0.975 | 1.181 | -0.734 | 1.181 | -0.909 | -1.491 | -0.218 | -0.704 | -0.098 | -0.613 | 0.594 | 1.181 | 1.181 |
Loops included in this Subclass |
Loop | PDB | Chain | Start | End | Sequence | Sec Struct | Ramachandran |
1aox_A_203 | 1aox | A | 203 | 232 | KEEMIVATSQTSQYGGDLTNTFGAIQYARK | HHHHHHHHHT------S---HHHHHHHHHH | aaaaaaaaaaxbxaeeabbxaaaaaaaaaa |
1ck4_A_206 | 1ck4 | A | 206 | 235 | TEEVLVAANKIGRQGGLQTMTALGIDTARK | HHHHHHHHHT------SS--HHHHHHHHHH | aaaaaaaaaaxxxaebaxbxaaaaaaaaaa |
1pt6_A_202 | 1pt6 | A | 202 | 231 | TEEVLVAAKKIVQRGGRQTMTALGTDTARK | HHHHHHHHHT------SS--HHHHHHHHHH | aaaaaaaaaaxbxaeeabbbaaaaaaaaaa |
PDB ligands within a cut-off distance of 6 Å in this subclass |
Loop | PDB | Chain | Ligands | Residue |
1aox_A_203 | 1aox | A | MGMAGNESIUM ION | T - 221 |
1pt6_A_202 | 1pt6 | A | MGMAGNESIUM ION | G - 217 |
1pt6_A_202 | 1pt6 | A | MGMAGNESIUM ION | R - 218 |
1pt6_A_202 | 1pt6 | A | MGMAGNESIUM ION | T - 220 |
PDB Site Annotated loops in this subclass |
Loop | PDB | Chain | Site | Residue |
1aox_A_203 | 1aox | A | MGAMG BINDING SITE. | T - 221 |
Clusters included in this Subclass |
CLUSTER: HH.10.82 |