Information on SUBCLASS 11.13.1 |
Subclass Accession number: 5133
Subclass: 11.13.1 ![]() Type: HH alpha-alpha DB: ArchDB95 Image coordinates: ![]() ![]() Consensus coordinates: ![]() ![]() Conserved Annotation EC : 2.5 (>75 %) 2.5.1 (>75 %) 2.5.1.18 GO : GO:0004364 (>75 %) GO:0016765 (>75 %) SCOP : 47615 (>75 %) 47616 (>75 %) 47617 (>75 %) |
Number of loops: 3 Average sequence ID (%) : 86.3 +/- -61.8 Average RMSD (Å) : 0.167 +/- 0.058 Consensus geometry
|
Consensus Sequence: | SHGQDYLVGNpLpRh |
(φψ)-conformation: | aaUpababllbpbaa |
Pattern: | [Y] | [FL] | [P] | [A] | [F] | [E] | [K] | [V] | [L] | [K] | [S] | [H] | [G] | [Q] | [D] | [Y] | [L] | [V] | [G] | [N] | [KR] | [L] | [ST] | [R] | [AV] | [D] | [IV] | [H] | [L] | [LV] | [E] | [L] | [L] | [LY] | [Y] | [V] | [E] | [E] | [FL] |
Conservation: | 1.427 | -1.453 | 1.427 | -0.479 | 0.792 | 0.157 | 0.157 | -0.479 | -0.479 | 0.157 | -0.479 | 2.063 | 0.792 | 0.157 | 0.792 | 1.427 | -0.479 | -0.479 | 0.792 | 0.792 | -0.791 | -0.479 | -1.259 | 0.157 | -1.747 | 0.792 | -0.795 | 2.063 | -0.479 | -1.430 | 0.157 | -0.479 | -0.479 | -1.624 | 1.427 | -0.479 | 0.157 | 0.157 | -1.474 |
Loops included in this Subclass |
Loop | PDB | Chain | Start | End | Sequence | Sec Struct | Ramachandran |
1ev9_A_132 | 1ev9 | A | 132 | 170 | YLPAFEKVLKSHGQDYLVGNKLTRVDIHLLELLLYVEEF | HHHHHHHHHHHH--SSSSTTS--HHHHHHHHHHHHHHHH | aaaaaaaaaaaaUxababvlbxbaaaaaaaaaaaaaaaa |
1k3y_A_132 | 1k3y | A | 132 | 170 | YFPAFEKVLKSHGQDYLVGNKLSRADIHLVELLYYVEEL | HHHHHHHHHHHH--SSSSTTS--HHHHHHHHHHHHHHHH | aaaaaaaaaaaavxababvlbpbaaaaaaaaaaaaaaaa |
1ml6_A_131 | 1ml6 | A | 131 | 169 | YLPAFEKVLKSHGQDYLVGNRLTRVDVHLLELLLYVEEL | HHHHHHHHHHHH--SSSSTTS--HHHHHHHHHHHHHHHH | aaaaaaaaaaaaUxababvlbxbaaaaaaaaaaaaaaaa |
PDB ligands within a cut-off distance of 6 Å in this subclass |
Loop | PDB | Chain | Ligands | Residue |
1k3y_A_132 | 1k3y | A | GOLGLYCEROL | R - 155 |
1k3y_A_132 | 1k3y | A | GOLGLYCEROL | H - 159 |
Clusters included in this Subclass |
CLUSTER: HH.10.71 |