Information on SUBCLASS 19.1.1 |
Subclass Accession number: 5175
Subclass: 19.1.1 ![]() Type: HH alpha-alpha DB: ArchDB95 Image coordinates: ![]() ![]() Consensus coordinates: ![]() ![]() Conserved Annotation EC : 3.4 (>50 %) 3.4.22 (>50 %) 3.4.22.14 GO : GO:0004175 (>75 %) GO:0004197 (>75 %) GO:0008233 (>75 %) GO:0008234 (>75 %) SCOP : 54000 (>75 %) 54001 (>75 %) 54002 (>75 %) |
Number of loops: 3 Average sequence ID (%) : 63.7 +/- -10.5 Average RMSD (Å) : 0.267 +/- 0.115 Consensus geometry
|
Consensus Sequence: | ppGGIpTEXNYPYpApDGpCcVX |
(φψ)-conformation: | aalebppaaabppalbpbpppaa |
Pattern: | [IM] | [DT] | [DY] | [AG] | [F] | [EQ] | [F] | [I] | [IK] | [NQ] | [DNR] | [G] | [G] | [I] | [NT] | [T] | [E] | [AE] | [N] | [Y] | [P] | [Y] | [ET] | [A] | [QY] | [D] | [G] | [DET] | [C] | [DN] | [V] | [ADS] | [KL] | [EQ] |
Conservation: | -0.614 | -0.851 | -1.087 | -0.692 | 0.949 | -0.243 | 0.949 | -0.006 | -1.567 | -0.585 | -1.121 | 0.949 | 0.949 | -0.006 | -0.585 | 0.472 | 0.472 | -1.063 | 0.949 | 1.427 | 1.427 | 1.427 | -0.957 | -0.006 | -0.745 | 0.949 | 0.949 | -1.068 | 2.383 | -0.199 | -0.006 | -1.280 | -1.329 | -0.243 |
Loops included in this Subclass |
Loop | PDB | Chain | Start | End | Sequence | Sec Struct | Ramachandran |
1aec_*_70 | 1aec | - | 70 | 103 | ITDGFQFIINNGGINTEENYPYTAQDGECNVDLQ | HHHHHHHHHHHT-B-BTTTS---SS-----HHHH | aaaaaaaaaaavebxxaaabxxavbxbxpxaaaa |
1s4v_A_70 | 1s4v | A | 70 | 103 | MDYAFEFIKQRGGITTEANYPYEAYDGTCDVSKE | HHHHHHHHHHHT-B-BTTTS---SS-----HHHH | aaaaaaaaaaavebxxaaabxxalbxxxpxaaaa |
2act_*_70 | 2act | - | 70 | 103 | ITDGFQFIINDGGINTEENYPYTAQDGDCDVALQ | HHHHHHHHHHHT-B-BTTTS---SS-----HHHH | aaaaaaaaaaavebxxaaabxxavbxbxpxaaaa |
PDB ligands within a cut-off distance of 6 Å in this subclass |
Loop | PDB | Chain | Ligands | Residue |
1aec_*_70 | 1aec | * | E64N-[N-[1-HYDROXYCARBOXYETHYL-CARBONYL]LEUCYLAMINO-BUTYL]-GUANIDINE | I - 70 |
Clusters included in this Subclass |
CLUSTER: HH.18.10 |