Information on SUBCLASS 26.1.1 |
Subclass Accession number: 6026
Subclass: 26.1.1 Type: HE alpha-beta DB: ArchDB95 Image coordinates: Consensus coordinates: Conserved Annotation GO : GO:0001871 (>75 %) GO:0005102 (>75 %) GO:0005529 (>75 %) GO:0008061 (>75 %) GO:0008083 (>75 %) GO:0030246 (>75 %) GO:0030247 (>75 %) SCOP : 57015 (>75 %) 57016 (>75 %) 57017 (>75 %) |
Number of loops: 3 Average sequence ID (%) : 67.7 +/- -19.4 Average RMSD (Å) : 0.433 +/- 0.153 Consensus geometry
|
Consensus Sequence: | pCGpGCQSQCpYXRCGppFGGpXCppphCC |
(φψ)-conformation: | aapplpablaaaabbeaaallpbppllppb |
Pattern: | [DE] | [EGN] | [HY] | [C] | [G] | [EKQ] | [G] | [C] | [Q] | [S] | [Q] | [C] | [DS] | [Y] | [NW] | [R] | [C] | [G] | [KR] | [DE] | [F] | [G] | [G] | [KR] | [EL] | [C] | [EHT] | [DE] | [DE] | [LM] | [C] | [C] |
Conservation: | -0.555 | -1.494 | -0.184 | 1.508 | 0.316 | -1.053 | 0.316 | 1.508 | -0.081 | -0.479 | -0.081 | 1.508 | -0.984 | 0.713 | -1.067 | -0.081 | 1.508 | 0.316 | -0.659 | -0.555 | 0.316 | 0.316 | 0.316 | -0.673 | -1.776 | 1.508 | -1.538 | -0.590 | -0.555 | -0.755 | 1.508 | 1.508 |
Loops included in this Subclass |
Loop | PDB | Chain | Start | End | Sequence | Sec Struct | Ramachandran |
1uha_A_29 | 1uha | A | 29 | 60 | DNYCGQGCQSQCDYWRCGRDFGGRLCEEDMCC | HHHHSTT--B-TTTTB-BGGGTTB--STT-EE | aaaaFxvpablaaaabbeaaavvpxxxllxxb |
1ulk_A_29 | 1ulk | A | 29 | 60 | EEYCGKGCQSQCDYNRCGKEFGGKECHDELCC | HHHHSTT--B-TTTTB-BGGGTTB--GGG-EE | aaaaxpvpablaaaabbeaaavvxbxxllxxb |
1ulk_A_70 | 1ulk | A | 70 | 101 | DGHCGEGCQSQCSYWRCGKDFGGRLCTEDMCC | HHHHSTT--B-TTTTB-BGGGTTB--STT-EE | aaaaxpvpablaaaabbeaaaUvpbxxllxxb |
PDB ligands within a cut-off distance of 6 Å in this subclass |
Loop | PDB | Chain | Ligands | Residue |
1uha_A_29 | 1uha | A | CACALCIUM ION | D - 57 |
Clusters included in this Subclass |
CLUSTER: HE.25.0 |