Information on SUBCLASS 22.2.1 |
Subclass Accession number: 6944
Subclass: 22.2.1 ![]() Type: AR beta-beta link DB: ArchDB-EC Image coordinates: ![]() ![]() Consensus coordinates: ![]() ![]() |
Number of loops: 3 Average sequence ID (%) : 69.7 +/- -22.9 Average RMSD (Å) : 0.300 +/- 0.100 Consensus geometry
|
Consensus Sequence: | IPFApPPhGXXRFXPPpPXpPWShVX |
(φψ)-conformation: | pwabppapeaaplpppbppppbpebp |
Pattern: | [V] | [AS] | [AI] | [F] | [L] | [G] | [I] | [P] | [F] | [A] | [EK] | [P] | [P] | [LMV] | [G] | [PS] | x | [R] | [F] | [LMT] | [P] | [P] | [EQ] | [P] | [AK] | [EQR] | [P] | [W] | [S] | [FG] | [V] | [KLV] | [DN] |
Conservation: | -0.196 | -0.829 | -1.250 | 0.652 | -0.196 | 0.652 | -0.196 | 1.076 | 0.652 | -0.196 | -0.615 | 1.076 | 1.076 | -0.903 | 0.652 | -0.802 | -1.339 | 0.228 | 0.652 | -1.232 | 1.076 | 1.076 | -0.405 | 1.076 | -1.128 | -0.903 | 1.076 | 2.772 | -0.196 | -1.246 | -0.196 | -1.562 | -0.402 |
Loops included in this Subclass |
Loop | PDB | Chain | Start | End | Sequence | Sec Struct | Ramachandran |
1b41_A_29 | 1b41 | A | 29 | 61 | VSAFLGIPFAEPPMGPRRFLPPEPKQPWSGVVD | EEEEEEEE-B----GGGTTS---B----SSEEE | bxbbbvxwabxpaxeaapvxpxbpxxpbxebxx |
1mx1_A_1047 | 1mx1 | A | 1047 | 1079 | VAIFLGIPFAKPPLGPLRFTPPQPAEPWSFVKN | EEEEEEEE-S----GGGTTS--------SSEEE | xxbbxlxwabxpaxeaaxvbwxbpxxxbxebxx |
1n5m_A_27 | 1n5m | A | 29 | 61 | VSAFLGIPFAEPPVGSRRFMPPEPKRPWSGVLD | EEEEEEEE-B----GGGTTS---B----SSEEE | bxbbbvxwabxpabeaapvxpxbpxxpbbexxx |
PDB ligands within a cut-off distance of 6 Å in this subclass |
Loop | PDB | Chain | Ligands | Residue |
1mx1_A_1047 | 1mx1 | A | SIAO-SIALIC ACID | F - 1050 |
1mx1_A_1047 | 1mx1 | A | SIAO-SIALIC ACID | L - 1051 |
1mx1_A_1047 | 1mx1 | A | SIAO-SIALIC ACID | G - 1052 |
1mx1_A_1047 | 1mx1 | A | SIAO-SIALIC ACID | I - 1053 |
1mx1_A_1047 | 1mx1 | A | SIAO-SIALIC ACID | P - 1054 |
1mx1_A_1047 | 1mx1 | A | SIAO-SIALIC ACID | K - 1078 |
1mx1_A_1047 | 1mx1 | A | NAGN-ACETYL-D-GLUCOSAMINE | N - 1079 |
1mx1_A_1047 | 1mx1 | A | SIAO-SIALIC ACID | N - 1079 |
1n5m_A_27 | 1n5m | A | IODIODIDE ION | G - 27 |
1n5m_A_27 | 1n5m | A | IODIODIDE ION | P - 28 |
Clusters included in this Subclass |
CLUSTER: AR.21.1 |