Information on SUBCLASS 6.46.1 |
Subclass Accession number: 7571
Subclass: 6.46.1 Type: EH beta-alpha DB: ArchDB-EC Image coordinates: Consensus coordinates: |
Number of loops: 3 Average sequence ID (%) : 45.6 +/- 10.0 Average RMSD (Å) : 0.367 +/- 0.058 Consensus geometry
|
Consensus Sequence: | phhSpphpcc |
(φψ)-conformation: | bbpaaapbaa |
Pattern: | [N] | [V] | [KR] | [G] | [E] | [Q] | [FV] | x | [NQ] | [IM] | [AG] | [S] | [EQ] | [DNS] | [IM] | [NT] | [DGN] | [DN] | [DV] | [LVW] | [L] | [KT] | [L] | [AGS] | [KQ] | [KR] | [IV] | [AN] | [ET] | x |
Conservation: | 2.134 | 0.704 | 0.402 | 2.134 | 1.419 | 1.419 | -0.771 | -1.441 | -0.006 | -0.202 | -0.440 | 0.704 | 0.382 | -0.567 | -0.043 | -0.189 | -0.726 | 0.407 | -1.455 | -1.282 | 0.704 | -0.654 | 0.704 | -0.885 | 0.077 | 0.382 | 0.358 | -0.791 | -0.654 | -1.821 |
Loops included in this Subclass |
Loop | PDB | Chain | Start | End | Sequence | Sec Struct | Ramachandran |
1nns_A_47 | 1nns | A | 47 | 76 | NVKGEQVVNIGSQDMNDNVWLTLAKKINTD | EEEEEEEEEE-GGG--HHHHHHHHHHHHHH | xxbbbxabbbxaaapbaaaaaaaaaaaaaa |
1o7j_A_51 | 1o7j | A | 51 | 80 | NVKGEQFSNMASENMTGDVVLKLSQRVNEL | EEEEEEEEEE-GGG--HHHHHHHHHHHHHH | xbbxbxabbbxaaaxbaaaaaaaaaaaaaa |
4pga_A_56 | 4pga | A | 56 | 85 | NVRGEQVMQIASESITNDDLLKLGKRVAEL | EEEEEEEEEE-GGG--HHHHHHHHHHHHHH | xbbbbxabbbxaaaxbaaaaaaaaaaaaaa |
PDB ligands within a cut-off distance of 6 Å in this subclass |
Loop | PDB | Chain | Ligands | Residue |
1nns_A_47 | 1nns | A | ASPASPARTIC ACID | I - 56 |
1nns_A_47 | 1nns | A | ASPASPARTIC ACID | G - 57 |
1nns_A_47 | 1nns | A | ASPASPARTIC ACID | S - 58 |
1nns_A_47 | 1nns | A | ASPASPARTIC ACID | Q - 59 |
1o7j_A_51 | 1o7j | A | GOLGLYCEROL | T - 66 |
1o7j_A_51 | 1o7j | A | GOLGLYCEROL | G - 67 |
1o7j_A_51 | 1o7j | A | GOLGLYCEROL | D - 68 |
1o7j_A_51 | 1o7j | A | GOLGLYCEROL | L - 71 |
PDB Site Annotated loops in this subclass |
Loop | PDB | Chain | Site | Residue |
1o7j_A_51 | 1o7j | A | AC2SO4 BINDING SITE FOR CHAIN A | M - 60 |
1o7j_A_51 | 1o7j | A | AC2SO4 BINDING SITE FOR CHAIN A | A - 61 |
1o7j_A_51 | 1o7j | A | AC2SO4 BINDING SITE FOR CHAIN A | N - 64 |
1o7j_A_51 | 1o7j | A | AC3GOL BINDING SITE FOR CHAIN A | D - 68 |
Clusters included in this Subclass |
CLUSTER: EH.5.150 |