Information on SUBCLASS 11.6.1 |
Subclass Accession number: 7665
Subclass: 11.6.1 Type: EH beta-alpha DB: ArchDB-EC Image coordinates: Consensus coordinates: |
Number of loops: 3 Average sequence ID (%) : 38.4 +/- 14.8 Average RMSD (Å) : 0.567 +/- 0.208 Consensus geometry
|
Consensus Sequence: | XhXXhHGhNRhhXNS |
(φψ)-conformation: | bbalaaeabppplaa |
Pattern: | [AS] | [CY] | [TVW] | [DGS] | [LMV] | [H] | [G] | [AF] | [N] | [R] | [LM] | [AG] | [GS] | [N] | [S] | [LV] | x | [DE] | [ACL] | [LV] | [V] | [AFY] | [G] | x | x | [AV] | [AG] | [EL] | [DHY] | [FIL] | [AQT] | [ER] | [HRS] |
Conservation: | -0.203 | 0.278 | -1.009 | -0.763 | -0.332 | 2.806 | 1.698 | -0.811 | 1.698 | 1.145 | 0.148 | -0.061 | -0.061 | 1.698 | 0.591 | -0.188 | -0.967 | 0.448 | -0.824 | -0.203 | 0.591 | -0.701 | 1.698 | -0.947 | -1.132 | -0.448 | -0.061 | -0.987 | -0.578 | -0.516 | -1.009 | -0.178 | -0.824 |
Loops included in this Subclass |
Loop | PDB | Chain | Start | End | Sequence | Sec Struct | Ramachandran |
1chu_A_377 | 1chu | A | 377 | 409 | SYTGLHGANRMASNSLLECLVYGWSAAEDITRR | EE-SSSTTS--TTHHHHHHHHHHHHHHHHHHHH | bbavaaeabbxpvaaaaaaaaaaaaaaaaaaaa |
1nek_A_390 | 1nek | A | 390 | 422 | ACVSVHGANRLGGNSLLDLVVFGRAAGLHLQES | EE-SSSTTS--TTHHHHHHHHHHHHHHHHHHHH | bbavaaeabxxpvaaaaaaaaaaaaaaaaaaaa |
1qla_A_395 | 1qla | A | 395 | 427 | ACWDMHGFNRLGGNSVSEAVVAGMIVGEYFAEH | EE--SSTTS--TTSHHHHHHHHHHHHHHHHHHH | bbavaaeabxxpvaaaaaaaaaaaaaaaaaaaa |
PDB ligands within a cut-off distance of 6 Å in this subclass |
Clusters included in this Subclass |
CLUSTER: EH.11.5 |