ArchDB - Biological DataBase of Protein Loops

Information on SUBCLASS 15.4.1

Subclass Accession number: 7699
Subclass: 15.4.1

Type: EH beta-alpha
DB: ArchDB-EC

Image coordinates:

Consensus coordinates:

Number of loops: 3

Average sequence ID (%) : 62.4 +/- -10.0
Average RMSD (Å) : 0.267 +/- 0.058

Consensus geometry

d (Å): 23

delta (°): 0-45

theta (°): 135-180

rho (°): 315-360

Consensus Sequence:	LKPNMVThGpXCTXKppXp
(φψ)-conformation:	bbppppbppaapappbpaa

Pattern:	[L]	[L]	[K]	[P]	[N]	[M]	[V]	[T]	[AP]	[G]	[HY]	[AE]	[C]	[T]	[AKQ]	[K]	[TY]	[ST]	[HPT]	[EQ]	[DEQ]	[IV]	[AG]	[FM]	[AL]	[T]	[V]	[RT]	[AT]	[L]	[HR]
Conservation:	0.111	0.111	0.667	1.781	1.224	0.667	0.111	0.667	-0.955	1.224	0.574	-1.155	2.895	0.667	-1.374	0.667	-0.921	-0.505	-1.498	-0.159	-0.632	-0.159	-0.768	-0.598	-1.266	0.667	0.111	-0.985	-0.879	0.111	-0.402

Loops included in this Subclass

Loop	PDB	Chain	Start	End	Sequence	Sec Struct	Ramachandran
1a5c_A_234	1a5c	A	234	264	LLKPNMVTAGYECTAKTTTQDVGFLTVRTLR	EE--B-----TT--S---HHHHHHHHHHHHH	bbbxxxxbxxaaxapxxbaaaaaaaaaaaaa
1ado_A_227	1ado	A	227	257	LLKPNMVTPGHACTQKYSHEEIAMATVTALR	EE--------TT--S---HHHHHHHHHHHHH	bbbbxxxbwxaaxaxxbxaaaaaaaaaaaaa
1fdj_A_1227	1fdj	A	1227	1257	LLKPNMVTAGHACTKKYTPEQVAMATVTALH	EE--------TT-S----HHHHHHHHHHHHH	bbbwxxxbxxaaxaxxbxaaaaaaaaaaaaa

PDB ligands within a cut-off distance of 6 Å in this subclass

Loop	PDB	Chain	Ligands	Residue
1ado_A_227	1ado	A	13P1,3-DIHYDROXYACETONEPHOSPHATE	K - 229
1fdj_A_1227	1fdj	A	2FP1,6-FRUCTOSE DIPHOSPHATE (LINEAR FORM)	K - 1229

Clusters included in this Subclass