Information on SUBCLASS 5.52.1 |
Subclass Accession number: 8630
Subclass: 5.52.1 Type: HE alpha-beta DB: ArchDB-EC Image coordinates: Consensus coordinates: |
Number of loops: 2 Average sequence ID (%) : 21.9 +/- 0.0 Average RMSD (Å) : 0.300 +/- 0.000 Consensus geometry
|
Consensus Sequence: | ppChXGIph |
(φψ)-conformation: | aa_aaapbb |
Pattern: | [ER] | [P] | [MV] | [IV] | [GI] | [HQ] | [AN] | [FM] | [FL] | [EQ] | [S] | [V] | [HR] | [IL] | [L] | [AT] | [DN] | [AG] | [CM] | [EY] | [NS] | [FL] | x | [EK] | [HK] | [C] | [AI] | [NV] | [G] | [I] | [ET] | [AP] |
Conservation: | -0.356 | 2.306 | -0.208 | 0.236 | -1.539 | 0.088 | -0.947 | -0.208 | -0.356 | 0.236 | 0.531 | 0.531 | 0.088 | -0.060 | 0.531 | -0.504 | 0.236 | -0.356 | -0.060 | -0.652 | -0.060 | -0.356 | -1.243 | -0.060 | -0.208 | 3.489 | -0.947 | -1.243 | 1.714 | 0.531 | -0.652 | -0.504 |
Loops included in this Subclass |
Loop | PDB | Chain | Start | End | Sequence | Sec Struct | Ramachandran |
1fur_A_362 | 1fur | A | 362 | 393 | RPMVIHNFLQSVRLLADGMESFNKHCAVGIEP | HHHHHHHHHHHHHHHHHHHHHHHHHTGGG-EE | aaaaaaaaaaaaaaaaaaaaaaaaaIaaaxbx |
1jsw_A_365 | 1jsw | A | 365 | 396 | EPVIGQAMFESVHILTNACYNLLEKCINGITA | HHHHHHHHHHHHHHHHHHHHHHHHHTGGG-EE | aaaaaaaaaaaaaaaaaaaaaaaaaaaaaxbb |
PDB ligands within a cut-off distance of 6 Å in this subclass |
Loop | PDB | Chain | Ligands | Residue |
1jsw_A_365 | 1jsw | A | GLCGLUCOSE | N - 381 |
1jsw_A_365 | 1jsw | A | GLCGLUCOSE | Y - 384 |
1jsw_A_365 | 1jsw | A | GLCGLUCOSE | E - 388 |
Clusters included in this Subclass |
CLUSTER: HE.6.239 |