Information on SUBCLASS 1.1.39 |
Subclass Accession number: 8821
Subclass: 1.1.39 Type: HH alpha-alpha DB: ArchDB-EC Image coordinates: Consensus coordinates: |
Number of loops: 2 Average sequence ID (%) : 11.1 +/- 0.0 Average RMSD (Å) : 0.500 +/- 0.000 Consensus geometry
|
Consensus Sequence: | ppcXp |
(φψ)-conformation: | aapaa |
Pattern: | [GP] | [AR] | [A] | [KN] | [AI] | [AF] | [KL] | [KL] | [AL] | [A] | x | [IT] | [L] | [AI] | [ET] | [HR] | [DN] | [AK] | [DE] | [AL] | [HR] | [QR] | [RY] | [FL] | [EN] | x | [AW] | [QR] | [K] | [AL] | [EQ] | [ET] | x | [EG] | [IV] | [KL] |
Conservation: | -0.097 | -0.564 | 1.536 | 0.369 | -0.797 | -0.797 | -1.031 | -1.031 | -0.797 | 1.536 | -1.031 | -0.564 | 1.536 | -0.797 | -0.331 | 0.836 | 1.070 | -0.564 | 1.303 | -0.797 | 0.836 | 0.603 | -0.331 | 0.136 | 0.369 | -1.264 | -0.097 | 0.603 | 2.470 | -0.797 | 1.070 | -0.331 | -1.731 | -0.564 | 1.070 | -1.031 |
Loops included in this Subclass |
Loop | PDB | Chain | Start | End | Sequence | Sec Struct | Ramachandran |
1o7x_A_266 | 1o7x | A | 266 | 301 | PRAKIFKKLALTLIERNADARRYFEIAQKLEELGIK | HHHHHHHHHHHHHHTT-HHHHHHHHHHHHHHHHHHH | aaaaaaaaaaaaaaaaxaaaaaaaaaaaaaaaaaaa |
1qcz_A_123 | 1qcz | A | 125 | 160 | GAANAALLAAQILATHDKELHQRLNDWRKAQTDEVL | HHHHHHHHHHHHHHTT-HHHHHHHHHHHHHHHHHHH | aaaaaaaaaaaaaaaabaaaaaaaaaaaaaaaaaaa |
PDB ligands within a cut-off distance of 6 Å in this subclass |
Loop | PDB | Chain | Ligands | Residue |
1qcz_A_123 | 1qcz | A | MSESELENOMETHIONINE | A - 126 |
1qcz_A_123 | 1qcz | A | MSESELENOMETHIONINE | A - 129 |
Clusters included in this Subclass |
CLUSTER: HH.3.187 |