Information on SUBCLASS 4.41.1 |
Subclass Accession number: 9090
Subclass: 4.41.1 ![]() Type: HH alpha-alpha DB: ArchDB-EC Image coordinates: ![]() ![]() Consensus coordinates: ![]() ![]() |
Number of loops: 2 Average sequence ID (%) : 6.1 +/- 0.0 Average RMSD (Å) : 1.400 +/- 0.000 Consensus geometry
|
Consensus Sequence: | XXcppppp |
(φψ)-conformation: | aalppbaa |
Pattern: | x | [GK] | [FL] | [KR] | [DG] | [MV] | [AY] | [AD] | [Y] | [AF] | [KR] | x | [AV] | x | x | x | [DG] | [EK] | [HR] | [ES] | [EN] | [RS] | [AL] | x | [AK] | [FL] | [MT] | [QR] | [DE] | [A] | [IL] | [AE] | [KL] |
Conservation: | -0.741 | -0.528 | 0.110 | 0.960 | 0.110 | 0.322 | -0.528 | -0.741 | 3.936 | -0.741 | 0.960 | -0.316 | -0.316 | -1.591 | -0.953 | -0.953 | 0.110 | 0.535 | 0.747 | -0.103 | 0.322 | -0.528 | -0.741 | -0.741 | -0.528 | 0.110 | -0.316 | 0.535 | 1.172 | 1.385 | 0.535 | -0.528 | -0.953 |
Loops included in this Subclass |
Loop | PDB | Chain | Start | End | Sequence | Sec Struct | Ramachandran |
1gnl_A_137 | 1gnl | A | 148 | 180 | FGLKGMAAYAKHADVLGKHENSLDAFMQEALAK | HHHHHHHHHHHHHHHTT---HHHHHHHHHHHHH | aaaaaaaaaaaaaaaavbbbaaaaaaaaaaaaa |
1ld8_A_94 | 1ld8 | A | 94 | 126 | DKFRDVYDYFRAVLQRDERSERAFKLTRDAIEL | HHHHHHHHHHHHHHHHT---HHHHHHHHHHHHH | aaaaaaaaaaaaaaaalxxbaaaaaaaaaaaaa |
PDB ligands within a cut-off distance of 6 Å in this subclass |
Loop | PDB | Chain | Ligands | Residue |
1gnl_A_137 | 1gnl | A | FSOIRON/SULFUR/OXYGEN HYBRID CLUSTER | Y - 156 |
Clusters included in this Subclass |
CLUSTER: HH.4.179 |