| Information on SUBCLASS 5.2.3 |
|
Subclass Accession number: 9097
Subclass: 5.2.3
Type: HH alpha-alpha DB: ArchDB-EC Image coordinates: ![]() Consensus coordinates:
Conserved Annotation EC : 3.2 (>75 %) 3.2.1 (>75 %) 3.2.1.1 GO : GO:0004553 (>75 %) GO:0005509 (>75 %) GO:0016160 (>75 %) GO:0016798 (>75 %) SCOP : 51445 (>75 %) 51446 (>75 %) |
Number of loops: 2 Average sequence ID (%) : 64.5 +/- 0.0 Average RMSD (Å) : 0.200 +/- 0.000 Consensus geometry
|
| Consensus Sequence: | FpSpSGShp |
| (φψ)-conformation: | aabaappaa |
| Pattern: | [Y] | [P] | [I] | [Y] | [WY] | [PQ] | [L] | [L] | [NY] | [A] | [F] | [EK] | [S] | [ST] | [S] | [G] | [S] | [IM] | [DS] | [DN] | [L] | [Y] | [N] | [M] | [I] | [KN] | [ST] | [V] | [AK] | [S] | [D] |
| Conservation: | 1.740 | 1.740 | -0.186 | 1.740 | 0.777 | -1.150 | -0.186 | -0.186 | -1.310 | -0.186 | 1.098 | -0.829 | -0.186 | -0.989 | -0.186 | 1.098 | -0.186 | -0.989 | -1.150 | -0.507 | -0.186 | 1.740 | 1.098 | 0.456 | -0.186 | -0.989 | -0.989 | -0.186 | -1.631 | -0.186 | 1.098 |
| Loops included in this Subclass |
| Loop | PDB | Chain | Start | End | Sequence | Sec Struct | Ramachandran |
| 2aaa_*_252 | 2aaa | - | 252 | 282 | YPIYWQLLYAFESSSGSISNLYNMIKSVASD | HHHHHHHHHHHSSTTS-HHHHHHHHHHHHHH | aaaaaaaaaaaabaaxxaaaaaaaaaaaaaa |
| 7taa_*_252 | 7taa | - | 252 | 282 | YPIYYPLLNAFKSTSGSMDDLYNMINTVKSD | HHHHHHHHHHHSSTT--HHHHHHHHHHHHHH | aaaaaaaaaaaabaapxaaaaaaaaaaaaaa |
| PDB ligands within a cut-off distance of 6 Å in this subclass |
| Loop | PDB | Chain | Ligands | Residue |
| 7taa_*_252 | 7taa | * | ABCMODIFIED ACARBOSE HEXASACCHARIDE | Y - 256 |
| Clusters included in this Subclass |
| CLUSTER: HH.7.58 |