Information on SUBCLASS 6.16.1 |
Subclass Accession number: 9145
Subclass: 6.16.1 Type: HH alpha-alpha DB: ArchDB-EC Image coordinates: Consensus coordinates: |
Number of loops: 3 Average sequence ID (%) : 58.3 +/- -2.4 Average RMSD (Å) : 0.233 +/- 0.058 Consensus geometry
|
Consensus Sequence: | hhpGXpCXXX |
(φψ)-conformation: | aalglpbbaa |
Pattern: | [F] | [DP] | [V] | [L] | [D] | [D] | [IL] | [Q] | [AQT] | [N] | [FLM] | [FY] | [HQ] | [G] | [GS] | [KQ] | [C] | [EG] | [AS] | [EP] | [AV] | [HR] | [EK] | x | [IL] | [R] | [ILM] | [V] | [F] | [H] | [D] | [AS] |
Conservation: | 1.022 | -0.605 | -0.000 | -0.000 | 1.022 | 1.022 | -0.507 | 0.511 | -1.477 | 1.022 | -0.966 | 0.368 | -0.303 | 1.022 | -0.712 | -0.503 | 2.556 | -1.113 | -0.761 | -0.798 | -1.015 | -0.303 | -0.503 | -1.591 | -0.487 | 0.511 | -0.739 | -0.000 | 1.022 | 2.045 | 1.022 | -0.761 |
Loops included in this Subclass |
Loop | PDB | Chain | Start | End | Sequence | Sec Struct | Ramachandran |
1llp_*_16 | 1llp | - | 18 | 49 | FDVLDDIQANMFHGGQCGAEAHESIRLVFHDS | HHHHHHHHHHTSTTT--SHHHHHHHHHHHHHH | aaaaaaaaaaaalvvxbbaaaaaaaaaaaaaa |
1lyc_A_25 | 1lyc | A | 26 | 57 | FDVLDDLQTNFYQGSKCESPVRKILRIVFHDA | HHHHHHHHHTTTTTT--SHHHHHHHHHHHHHH | aaaaaaaaaaaalglxbbaaaaaaaaaaaaaa |
1qpa_A_18 | 1qpa | A | 18 | 49 | FPVLDDIQQNLFHGGQCGAEAHEALRMVFHDS | HHHHHHHHHHTSTTT--SHHHHHHHHHHHHHH | aaaaaaaaaaaalvvxxbaaaaaaaaaaaaaa |
PDB ligands within a cut-off distance of 6 Å in this subclass |
Clusters included in this Subclass |
CLUSTER: HH.8.35 |