Information on SUBCLASS 11.6.1 |
Subclass Accession number: 9239
Subclass: 11.6.1 Type: HH alpha-alpha DB: ArchDB-EC Image coordinates: Consensus coordinates: |
Number of loops: 3 Average sequence ID (%) : 60.5 +/- -6.6 Average RMSD (Å) : 0.267 +/- 0.058 Consensus geometry
|
Consensus Sequence: | XHGQphLVGNpLpXh |
(φψ)-conformation: | aalpababllbpbaa |
Pattern: | [FL] | [P] | [AV] | [F] | [E] | [K] | [IV] | [L] | [KR] | [GS] | [H] | [G] | [Q] | [DS] | [FY] | [L] | [V] | [G] | [N] | [KQR] | [L] | [ST] | x | [AV] | [D] | [IV] | [HI] | [L] | [LV] | [EQ] | [LTV] | [IL] | [LY] | [AY] | [LV] | [E] | [E] | [FKL] |
Conservation: | -0.564 | 1.868 | -1.012 | 1.290 | 0.712 | 0.712 | -0.153 | 0.133 | -0.147 | -0.777 | 2.447 | 1.290 | 0.712 | -0.664 | 0.605 | 0.133 | 0.133 | 1.290 | 1.290 | -0.702 | 0.133 | -0.607 | -1.411 | -0.978 | 1.290 | -0.153 | -1.174 | 0.133 | -0.697 | -0.147 | -1.345 | -0.439 | -0.978 | -1.062 | -0.726 | 0.712 | 0.712 | -1.859 |
Loops included in this Subclass |
Loop | PDB | Chain | Start | End | Sequence | Sec Struct | Ramachandran |
1f3a_A_131 | 1f3a | A | 132 | 169 | LPAFEKVLKSHGQDYLVGNRLTRVDIHLLEVLLYVEEF | HHHHHHHHHHH--SSSSTTS--HHHHHHHHHHHHHHHH | aaaaaaaaaaaUxababvlbxbaaaaaaaaaaaaaaaa |
1gum_A_133 | 1gum | A | 133 | 170 | FPVFEKILRGHGQSFLVGNQLSLADVILLQTILALEEK | HHHHHHHHHTT--SSSSTTS--HHHHHHHHHHHHHHHH | aaaaaaaaaaavxababllbpbaaaaaaaaaaaaaaaa |
1k3y_A_132 | 1k3y | A | 133 | 170 | FPAFEKVLKSHGQDYLVGNKLSRADIHLVELLYYVEEL | HHHHHHHHHHH--SSSSTTS--HHHHHHHHHHHHHHHH | aaaaaaaaaaavxababvlbpbaaaaaaaaaaaaaaaa |
PDB ligands within a cut-off distance of 6 Å in this subclass |
Loop | PDB | Chain | Ligands | Residue |
1k3y_A_132 | 1k3y | A | GOLGLYCEROL | R - 155 |
1k3y_A_132 | 1k3y | A | GOLGLYCEROL | H - 159 |
Clusters included in this Subclass |
CLUSTER: HH.12.13 |