hmmsearch - search a sequence database with a profile HMM HMMER 2.2g (August 2001) Copyright (C) 1992-2001 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: kinassa.hmm [homologues] Sequence database: /disc9/DB/blast/pdb_seq per-sequence score cutoff: [none] per-domain score cutoff: [none] per-sequence Eval cutoff: <= 10 per-domain Eval cutoff: [none] - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query HMM: homologues Accession: [none] Description: [none] [HMM has been calibrated; E-values are empirical estimates] Scores for complete sequences (score includes all domains): Sequence Description Score E-value N -------- ----------- ----- ------- --- pdb|1G99|1G99-A acetate kinase 736.8 3.7e-218 1 Parsed for domains: Sequence Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- pdb|1G99|1G99-A 1/1 1 397 [. 1 407 [] 736.8 3.7e-218 Alignments of top-scoring domains: pdb|1G99|1G99-A: domain 1 of 1, from 1 to 397: score 736.8, E = 3.7e-218 *->mmyKiLvINaGSSSlKFQLlEmedSAieevLakGlverIGeedsrlt +K+LvINaGSSSlK+QL++m + e La Gl erIG+ +s +t pdb|1G99|1 1 --MKVLVINAGSSSLKYQLIDMTN---ESALAVGLCERIGIDNSIIT 42 ikygDgeKykevtdvadHkeAikllLdeLeg.eygiikslseIdgvGGMH k Dg K td ++Hk+A+ + ++L+ +e+g+ik++ eI +vG H pdb|1G99|1 43 QKKFDGKKLEKLTDLPTHKDALEEVVKALTDdEFGVIKDMGEINAVG--H 90 RVVHGGelFsdSvliTDevleeIrrlieLAPLHNPaNiiGIkifrqLlPd RVVHGGe+F+ S+l v ++I+++ eLAPLHNP N GI+++ +++P+ pdb|1G99|1 91 RVVHGGEKFTTSALYDEGVEKAIKDCFELAPLHNPPNMMGISACAEIMPG 140 VPsVAVFDTaFhqTLapeAYLYgiPweYYeefGIRKYGFHGTSHkYVskR P+V VFDTaFhqT++p+AY Y++P++ Ye++G+RKYGFHGTSHkYV++R pdb|1G99|1 141 TPMVIVFDTAFHQTMPPYAYMYALPYDLYEKHGVRKYGFHGTSHKYVAER 190 aaeiLgkPledlnlItcHLGNGaSIaAVknGksVDTSMGfTPLaGlmMGT aa LgkP e ++ItcHLGNG+SI+AV++GksV TSMGfTPL+Gl+MGT pdb|1G99|1 191 AALMLGKPAEETKIITCHLGNGSSITAVEGGKSVETSMGFTPLEGLAMGT 240 RSGdIDpgilsylaektnqSadEvenlLNkKSGllGiSGlSSDlRdleea R G+IDp+i+++l+ek++ + E++ l NkKSG+lG+SGlS D+Rdl ea pdb|1G99|1 241 RCGSIDPAIVPFLMEKEGLTTREIDTLMNKKSGVLGVSGLSNDFRDLDEA 290 aeeGGdkrAelAlkiFvyRIrkyIGSYaaalgGKVDtIvFTaGIGENssl a +G ++ AelAl+iF+y ++k IG+Y+a+l+G D+ vFTaGIGENs+ pdb|1G99|1 291 ASKG-NRKAELALEIFAYKVKKFIGEYSAVLNG-ADAVVFTAGIGENSAS 338 vRelvlkgLeflGvevDpEkNnvsNrggerlIStenskVkVlviPTNEEl +R ++l gL G+++D EkN++ rg+e ISt+++kV+V+viPTNEEl pdb|1G99|1 339 IRKRILTGLDGIGIKIDDEKNKI--RGQEIDISTPDAKVRVFVIPTNEEL 386 MIArDvvrlak<-* +IAr + +++ pdb|1G99|1 387 AIARETKEIVE 397 Histogram of all scores: score obs exp (one = represents 7 sequences) ----- --- --- <-570 2 -|= -570 1 0|= -569 0 0| -568 0 0| -567 1 0|= -566 0 0| -565 2 0|= -564 1 0|= -563 0 0| -562 4 0|= -561 3 0|= -560 8 0|== -559 1 0|= -558 11 0|== -557 18 0|=== -556 24 0|==== -555 93 0|============== -554 26 0|==== -553 38 0|====== -552 33 0|===== -551 33 0|===== -550 35 0|===== -549 34 0|===== -548 29 0|===== -547 41 0|====== -546 53 0|======== -545 45 0|======= -544 33 0|===== -543 43 0|======= -542 40 0|====== -541 88 0|============= -540 34 0|===== -539 37 0|====== -538 26 0|==== -537 28 0|==== -536 31 0|===== -535 50 0|======== -534 23 0|==== -533 20 0|=== -532 21 0|=== -531 27 0|==== -530 65 0|========== -529 27 0|==== -528 11 0|== -527 28 0|==== -526 13 0|== -525 38 0|====== -524 19 0|=== -523 21 0|=== -522 40 0|====== -521 24 0|==== -520 15 0|=== -519 20 0|=== -518 9 0|== -517 21 0|=== -516 23 0|==== -515 53 0|======== -514 62 0|========= -513 43 0|======= -512 60 0|========= -511 31 0|===== -510 43 0|======= -509 30 0|===== -508 31 0|===== -507 23 0|==== -506 28 0|==== -505 37 0|====== -504 24 0|==== -503 56 0|======== -502 33 0|===== -501 31 0|===== -500 22 0|==== -499 23 0|==== -498 39 0|====== -497 21 0|=== -496 14 0|== -495 28 0|==== -494 22 0|==== -493 24 0|==== -492 49 0|======= -491 67 0|========== -490 35 0|===== -489 44 0|======= -488 60 0|========= -487 56 0|======== -486 59 0|========= -485 53 0|======== -484 34 0|===== -483 42 0|====== -482 29 0|===== -481 40 0|====== -480 49 0|======= -479 60 0|========= -478 43 0|======= -477 52 0|======== -476 35 0|===== -475 32 0|===== -474 32 0|===== -473 42 0|====== -472 49 0|======= -471 34 0|===== -470 45 0|======= -469 41 0|====== -468 50 0|======== -467 67 0|========== -466 54 0|======== -465 44 0|======= -464 49 0|======= -463 72 0|=========== -462 61 0|========= -461 54 0|======== -460 51 0|======== -459 50 0|======== -458 60 0|========= -457 65 0|========== -456 69 0|========== -455 61 0|========= -454 53 0|======== -453 43 0|======= -452 52 0|======== -451 51 0|======== -450 48 0|======= -449 75 0|=========== -448 93 0|============== -447 45 0|======= -446 73 0|=========== -445 95 0|============== -444 81 0|============ -443 98 0|============== -442 149 0|====================== -441 90 0|============= -440 141 0|===================== -439 115 0|================= -438 80 0|============ -437 91 0|============= -436 114 0|================= -435 109 0|================ -434 95 0|============== -433 143 0|===================== -432 87 0|============= -431 219 0|================================ -430 128 0|=================== -429 125 0|================== -428 109 0|================ -427 89 0|============= -426 109 0|================ -425 95 0|============== -424 165 0|======================== -423 113 0|================= -422 127 0|=================== -421 115 0|================= -420 128 0|=================== -419 148 0|====================== -418 112 0|================ -417 141 0|===================== -416 110 0|================ -415 114 0|================= -414 93 0|============== -413 81 0|============ -412 147 0|===================== -411 102 0|=============== -410 142 0|===================== -409 116 0|================= -408 104 0|=============== -407 126 0|================== -406 148 0|====================== -405 142 0|===================== -404 88 0|============= -403 143 0|===================== -402 185 0|=========================== -401 202 0|============================= -400 217 0|=============================== -399 199 0|============================= -398 163 0|======================== -397 176 0|========================== -396 178 0|========================== -395 234 0|================================== -394 135 0|==================== -393 195 0|============================ -392 208 0|============================== -391 217 0|=============================== -390 180 0|========================== -389 168 0|======================== -388 206 0|============================== -387 247 0|==================================== -386 159 0|======================= -385 180 0|========================== -384 194 0|============================ -383 149 0|====================== -382 152 0|====================== -381 216 0|=============================== -380 263 0|====================================== -379 225 0|================================= -378 363 0|==================================================== -377 228 0|================================= -376 191 2|*=========================== -375 195 6|*=========================== -374 337 14|=*=============================================== -373 233 30|====*============================= -372 241 58|========*========================== -371 202 102|==============*============== -370 150 163|====================== * -369 171 244|========================= * -368 176 341|========================== * -367 165 451|======================== * -366 192 569|============================ * -365 171 687|========================= * -364 176 799|========================== * -363 161 898|======================= * -362 193 980|============================ * -361 237 1042|================================== * -360 195 1083|============================ * -359 250 1104|==================================== * -358 195 1105|============================ * -357 245 1089|=================================== * -356 232 1059|================================== * -355 225 1017|================================= * -354 168 966|======================== * -353 190 910|============================ * -352 158 850|======================= * -351 201 788|============================= * -350 179 726|========================== * -349 236 665|================================== * -348 339 607|================================================= * -347 168 551|======================== * -346 241 498|=================================== * -345 237 449|================================== * -344 162 403|======================== * -343 151 362|====================== * -342 161 323|======================= * -341 143 289|===================== * -340 142 257|===================== * -339 119 229|================= * -338 82 203|============ * -337 100 180|=============== * -336 86 160|============= * -335 70 141|========== * -334 86 125|============= * -333 54 111|======== * -332 65 98|========== * -331 41 86|====== * -330 58 76|========= * -329 79 67|=========*== -328 61 59|========* -327 28 52|==== * -326 31 46|===== * -325 13 40|== * -324 13 35|== * -323 35 31|====* -322 15 27|===* -321 21 24|===* -320 17 21|==* -319 13 19|==* -318 11 16|==* -317 2 14|=* -316 6 12|=* -315 11 11|=* -314 2 10|=* -313 5 8|=* -312 13 7|*= -311 4 6|* -310 6 6|* -309 6 5|* -308 0 4|* -307 5 4|* -306 0 3|* -305 0 3|* -304 1 2|* -303 0 2|* >-302 2 -|= % Statistical details of theoretical EVD fit: mu = -357.9472 lambda = 0.1282 chi-sq statistic = 26624.5566 P(chi-square) = 0 Total sequences searched: 23487 Whole sequence top hits: tophits_s report: Total hits: 31 Satisfying E cutoff: 1 Total memory: 18K Domain top hits: tophits_s report: Total hits: 31 Satisfying E cutoff: 31 Total memory: 59K