hmmsearch - search a sequence database with a profile HMM HMMER 2.2g (August 2001) Copyright (C) 1992-2001 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: seq4.hmm [seqs_seq4PSIblast] Sequence database: /disc9/DB/blast/swissprot per-sequence score cutoff: [none] per-domain score cutoff: [none] per-sequence Eval cutoff: <= 10 per-domain Eval cutoff: [none] - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query HMM: seqs_seq4PSIblast Accession: [none] Description: [none] [No calibration for HMM; E-values are upper bounds] Scores for complete sequences (score includes all domains): Sequence Description Score E-value N -------- ----------- ----- ------- --- gi|141108|sp|P17778|YOPM_YERPE OUTER MEMBRANE PROTEIN 792.6 2.3e-234 1 Parsed for domains: Sequence Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- gi|141108|sp|P17778|YOPM_YERPE 1/1 1 367 [] 1 461 [] 792.6 2.3e-234 Alignments of top-scoring domains: gi|141108|sp|P17778|YOPM_YERPE: domain 1 of 1, from 1 to 367: score 792.6, E = 2.3e-234 *->mGHKvvvfdisViralleerlkkskaltkkeVEalekkakekikeeW +++++++V++++l+e+l++s++lt+++VEa+++k+k++++++W gi|141108| 1 ----MFINPRNVSNTFLQEPLRHSSNLTEMPVEAENVKSKTEYYNAW 43 severnarkGnieQavyaksrliDtlvRlldklElNtLtRlSSLPklrgk se+erna++Gn+eQ+++a+srl+D+l+R++++lElN+L+ lSSLP+l+++ gi|141108| 44 SEWERNAPPGNGEQREMAVSRLRDCLDRQAHELELNNLG-LSSLPELPPH 92 leSlvvfelSleeltELPdSLKellvDnnnLKALsDLrPLLEelyvSNtl leSlv++++Sl+el+ELP+SLK+llvDnnnLKALsDL+PLLE+l+vSN++ gi|141108| 93 LESLVASCNSLTELPELPQSLKSLLVDNNNLKALSDLPPLLEYLGVSNNQ 142 leklPtelQlfsalkIlDldkNslkkLPdligsLkflkelNnqLEELPEL le lP EL gi|141108| 143 LEELP-------------------------------------------EL 149 vnlnyLkaIyadlndlkkLedLdlSLEsivAGNliLeELPFELsNLkflT +nl++L+aIyad+n+lkkL+dL+lSLEsivAGN+iLeELP EL+NL+flT gi|141108| 150 QNLPFLTAIYADNNSLKKLPDLPLSLESIVAGNNILEELP-ELQNLPFLT 198 fvdidaNklkslPilvlrleaLnvlDiyltdLtdLPQdldfLDvsEniFs ++++d+N+lk+lP+l+++leaLnv+D+yltdL++LPQ+l+fLDvsEniFs gi|141108| 199 TIYADNNLLKTLPDLPPSLEALNVRDNYLTDLPELPQSLTFLDVSENIFS 248 GLeELqsfLlYkNkssnEiRsLtdLPySlleLkksnnKLiELPALPPRLe GL+EL+++L+Y+N+ssnEiRsL+dLP+Sl+eL++snnKLiELPALPPRLe gi|141108| 249 GLSELPPNLYYLNASSNEIRSLCDLPPSLEELNVSNNKLIELPALPPRLE 298 lLvvSfdHLvElPelPlnlkslhlkyvsLrdfPiinesvEDlRmnsHLaE +L++Sf+HL+E+PelP+nlk+lh++y++Lr+fP+i+esvEDl gi|141108| 299 RLIASFNHLAEVPELPQNLKQLHVEYNPLREFPDIPESVEDL-------- 340 vmElernLdrlHvdkevlkeyPDIPEsvEDLkereeRvVdsYefkvefsl ++++eRvVd+Yef++e+++ gi|141108| 341 -------------------------------RMNSERVVDPYEFAHETTD 359 kLEDDvFEHHHHHH<-* kLEDDvFE gi|141108| 360 KLEDDVFE------ 367 Histogram of all scores: score obs exp (one = represents 13 sequences) ----- --- --- -601 2 -|= -600 4 -|= -599 16 -|== -598 15 -|== -597 15 -|== -596 22 -|== -595 37 -|=== -594 54 -|===== -593 36 -|=== -592 53 -|===== -591 67 -|====== -590 73 -|====== -589 55 -|===== -588 61 -|===== -587 68 -|====== -586 56 -|===== -585 67 -|====== -584 60 -|===== -583 53 -|===== -582 70 -|====== -581 52 -|==== -580 58 -|===== -579 55 -|===== -578 69 -|====== -577 56 -|===== -576 56 -|===== -575 53 -|===== -574 59 -|===== -573 55 -|===== -572 66 -|====== -571 81 -|======= -570 65 -|===== -569 64 -|===== -568 59 -|===== -567 59 -|===== -566 53 -|===== -565 60 -|===== -564 59 -|===== -563 57 -|===== -562 56 -|===== -561 62 -|===== -560 60 -|===== -559 70 -|====== -558 58 -|===== -557 82 -|======= -556 54 -|===== -555 64 -|===== -554 65 -|===== -553 55 -|===== -552 51 -|==== -551 65 -|===== -550 66 -|====== -549 51 -|==== -548 75 -|====== -547 66 -|====== -546 70 -|====== -545 72 -|====== -544 58 -|===== -543 67 -|====== -542 71 -|====== -541 57 -|===== -540 86 -|======= -539 83 -|======= -538 74 -|====== -537 64 -|===== -536 64 -|===== -535 62 -|===== -534 72 -|====== -533 67 -|====== -532 51 -|==== -531 73 -|====== -530 72 -|====== -529 76 -|====== -528 69 -|====== -527 88 -|======= -526 81 -|======= -525 85 -|======= -524 80 -|======= -523 65 -|===== -522 83 -|======= -521 88 -|======= -520 90 -|======= -519 97 -|======== -518 90 -|======= -517 96 -|======== -516 94 -|======== -515 99 -|======== -514 115 -|========= -513 115 -|========= -512 92 -|======== -511 99 -|======== -510 104 -|======== -509 101 -|======== -508 123 -|========== -507 102 -|======== -506 118 -|========== -505 125 -|========== -504 118 -|========== -503 90 -|======= -502 117 -|========= -501 103 -|======== -500 95 -|======== -499 106 -|========= -498 123 -|========== -497 106 -|========= -496 113 -|========= -495 93 -|======== -494 115 -|========= -493 128 -|========== -492 131 -|=========== -491 120 -|========== -490 132 -|=========== -489 131 -|=========== -488 129 -|========== -487 116 -|========= -486 134 -|=========== -485 126 -|========== -484 119 -|========== -483 138 -|=========== -482 150 -|============ -481 146 -|============ -480 151 -|============ -479 165 -|============= -478 133 -|=========== -477 150 -|============ -476 149 -|============ -475 154 -|============ -474 155 -|============ -473 174 -|============== -472 164 -|============= -471 187 -|=============== -470 191 -|=============== -469 190 -|=============== -468 183 -|=============== -467 185 -|=============== -466 202 -|================ -465 192 -|=============== -464 189 -|=============== -463 181 -|============== -462 195 -|=============== -461 192 -|=============== -460 180 -|============== -459 198 -|================ -458 182 -|============== -457 205 -|================ -456 203 -|================ -455 232 -|================== -454 194 -|=============== -453 228 -|================== -452 232 -|================== -451 231 -|================== -450 196 -|================ -449 215 -|================= -448 213 -|================= -447 196 -|================ -446 200 -|================ -445 206 -|================ -444 223 -|================== -443 199 -|================ -442 204 -|================ -441 209 -|================= -440 207 -|================ -439 206 -|================ -438 236 -|=================== -437 200 -|================ -436 195 -|=============== -435 218 -|================= -434 167 -|============= -433 207 -|================ -432 231 -|================== -431 192 -|=============== -430 168 -|============= -429 203 -|================ -428 210 -|================= -427 197 -|================ -426 196 -|================ -425 224 -|================== -424 208 -|================ -423 206 -|================ -422 200 -|================ -421 223 -|================== -420 214 -|================= -419 224 -|================== -418 223 -|================== -417 249 -|==================== -416 226 -|================== -415 203 -|================ -414 219 -|================= -413 241 -|=================== -412 216 -|================= -411 255 -|==================== -410 213 -|================= -409 236 -|=================== -408 215 -|================= -407 228 -|================== -406 210 -|================= -405 203 -|================ -404 227 -|================== -403 225 -|================== -402 210 -|================= -401 211 -|================= -400 194 -|=============== -399 197 -|================ -398 210 -|================= -397 211 -|================= -396 201 -|================ -395 220 -|================= -394 206 -|================ -393 209 -|================= -392 232 -|================== -391 235 -|=================== -390 223 -|================== -389 223 -|================== -388 197 -|================ -387 254 -|==================== -386 228 -|================== -385 219 -|================= -384 223 -|================== -383 221 -|================= -382 212 -|================= -381 243 -|=================== -380 216 -|================= -379 214 -|================= -378 219 -|================= -377 237 -|=================== -376 211 -|================= -375 239 -|=================== -374 219 -|================= -373 218 -|================= -372 235 -|=================== -371 210 -|================= -370 217 -|================= -369 236 -|=================== -368 229 -|================== -367 233 -|================== -366 226 -|================== -365 247 -|=================== -364 261 -|===================== -363 277 -|====================== -362 244 -|=================== -361 260 -|==================== -360 240 -|=================== -359 259 -|==================== -358 228 -|================== -357 255 -|==================== -356 283 -|====================== -355 285 -|====================== -354 250 -|==================== -353 256 -|==================== -352 246 -|=================== -351 243 -|=================== -350 260 -|==================== -349 264 -|===================== -348 269 -|===================== -347 253 -|==================== -346 261 -|===================== -345 257 -|==================== -344 264 -|===================== -343 286 -|====================== -342 228 -|================== -341 244 -|=================== -340 282 -|====================== -339 286 -|====================== -338 270 -|===================== -337 254 -|==================== -336 266 -|===================== -335 244 -|=================== -334 294 -|======================= -333 253 -|==================== -332 282 -|====================== -331 291 -|======================= -330 273 -|===================== -329 286 -|====================== -328 264 -|===================== -327 284 -|====================== -326 281 -|====================== -325 290 -|======================= -324 302 -|======================== -323 310 -|======================== -322 300 -|======================== -321 301 -|======================== -320 319 -|========================= -319 344 -|=========================== -318 327 -|========================== -317 342 -|=========================== -316 340 -|=========================== -315 385 -|============================== -314 368 -|============================= -313 405 -|================================ -312 398 -|=============================== -311 404 -|================================ -310 407 -|================================ -309 416 -|================================ -308 409 -|================================ -307 412 -|================================ -306 479 -|===================================== -305 450 -|=================================== -304 483 -|====================================== -303 514 -|======================================== -302 471 -|===================================== -301 488 -|====================================== -300 562 -|============================================ -299 477 -|===================================== -298 517 -|======================================== -297 510 -|======================================== -296 541 -|========================================== -295 530 -|========================================= -294 504 -|======================================= -293 520 -|======================================== -292 562 -|============================================ -291 562 -|============================================ -290 567 -|============================================ -289 586 -|============================================== -288 564 -|============================================ -287 588 -|============================================== -286 660 -|=================================================== -285 613 -|================================================ -284 634 -|================================================= -283 580 -|============================================= -282 627 -|================================================= -281 632 -|================================================= -280 647 -|================================================== -279 614 -|================================================ -278 664 -|==================================================== -277 677 -|===================================================== -276 654 -|=================================================== -275 658 -|=================================================== -274 694 -|====================================================== -273 665 -|==================================================== -272 717 -|======================================================== -271 716 -|======================================================== -270 645 -|================================================== -269 652 -|=================================================== -268 727 -|======================================================== -267 690 -|====================================================== -266 692 -|====================================================== -265 672 -|==================================================== -264 653 -|=================================================== -263 658 -|=================================================== -262 613 -|================================================ -261 602 -|=============================================== -260 621 -|================================================ -259 612 -|================================================ -258 591 -|============================================== -257 596 -|============================================== -256 565 -|============================================ -255 552 -|=========================================== -254 492 -|====================================== -253 517 -|======================================== -252 498 -|======================================= -251 507 -|======================================= -250 525 -|========================================= -249 461 -|==================================== -248 423 -|================================= -247 402 -|=============================== -246 408 -|================================ -245 389 -|============================== -244 361 -|============================ -243 335 -|========================== -242 312 -|======================== -241 320 -|========================= -240 267 -|===================== -239 283 -|====================== -238 255 -|==================== -237 248 -|==================== -236 211 -|================= -235 177 -|============== -234 191 -|=============== -233 159 -|============= -232 154 -|============ -231 143 -|=========== -230 103 -|======== -229 111 -|========= -228 119 -|========== -227 111 -|========= -226 72 -|====== -225 62 -|===== -224 73 -|====== -223 51 -|==== -222 55 -|===== -221 49 -|==== -220 42 -|==== -219 35 -|=== -218 33 -|=== -217 31 -|=== -216 26 -|== -215 20 -|== -214 18 -|== -213 15 -|== -212 17 -|== -211 10 -|= -210 15 -|== -209 13 -|= -208 9 -|= -207 3 -|= -206 10 -|= -205 6 -|= -204 5 -|= -203 8 -|= -202 8 -|= -201 9 -|= -200 1 -|= -199 6 -|= -198 2 -|= -197 5 -|= -196 3 -|= -195 1 -|= -194 1 -|= -193 1 -|= -192 4 -|= -191 1 -|= -190 0 -| -189 2 -|= >-188 34 -|=== % No statistical fit available Total sequences searched: 90939 Whole sequence top hits: tophits_s report: Total hits: 11 Satisfying E cutoff: 1 Total memory: 16K Domain top hits: tophits_s report: Total hits: 11 Satisfying E cutoff: 11 Total memory: 33K