|
|
|
|
|
|
|
| Information on CLUSTER HE.15.6 |
Subclass Accession number: HE-14.3.1
DB: ArchDB95
| Loops included in this Cluster |
| Loop | PDB | Chain | Start | End | Sequence | Sec Struct | Ramachandran |
| 19hc_A_152 | 19hc | A | 152 | 183 | PGDNEALAAETVLAEATVAPVSPMLAPYKVVI | HHHHHHHHHHHHHH--------GGGS-S-EEE | aaaaaaaaaaaaaaxbxxxxpxaaabpabbxx |
| 1duw_A_152 | 1duw | A | 152 | 183 | PDQNEALAAETVLNHKPVQPLTAMQGPYKVSI | HHHHHHHHHHHHHH--------GGGS-S-EEE | aaaaaaaaaaaaaaxbpxxxxxaaabxabbxx |
| For any comment or web-related incidence, send an email to the webmaster. |
|