|
|
|
|
|
|
|
| Information on CLUSTER HE.4.261 |
Subclass Accession number: HE-1.2.24
DB: ArchDB-EC
| Loops included in this Cluster |
| Loop | PDB | Chain | Start | End | Sequence | Sec Struct | Ramachandran |
| 1fmc_A_157 | 1fmc | A | 158 | 189 | SYASSKAAASHLVRNMAFDLGEKNIRVNGIAP | HHHHHHHHHHHHHHHHHHHHHTTTEEEEEEEE | aaaaaaaaaaaaaaaaaaaaaaavbxbbbbbx |
| 1jw7_A_157 | 1jw7 | A | 157 | 188 | VMGLAKAALESAVRYLAVDLGKHHIRVNALSA | HHHHHHHHHHHHHHHHHHHHHTTT-EEEEEEE | aaaaaaaaaaaaaaaaaaaaaaavxbbbbxxx |
| For any comment or web-related incidence, send an email to the webmaster. |
|