|
|
|
|
|
|
|
| Information on CLUSTER HH.12.28 |
Subclass Accession number: HH-9.2.2
DB: ArchDB95
| Loops included in this Cluster |
| Loop | PDB | Chain | Start | End | Sequence | Sec Struct | Ramachandran |
| 1alv_A_159 | 1alv | A | 169 | 198 | IKKWQAIYKQFDVDRSGTIGSSELPGAFEA | HHHHHHHHHHH-TT--SSB-TTTHHHHHHH | aaaaaaaaaaaxaalavbbxaaaaaaaaaa |
| 1kfu_S_862 | 1kfu | S | 871 | 900 | IKRWQAIYKQFDTDRSGTICSSELPGAFEA | HHHHHHHHHHS-TT-SSSB-GGGHHHHHHH | aaaaaaaaaaabaalavbbpaaaaaaaaaa |
| 1np8_A_77 | 1np8 | A | 87 | 116 | IKKWQGIYKRFDTDRSGTIGSNELPGAFEA | HHHHHHHHHHH-TT-SSSB-TTTHHHHHHH | aaaaaaaaaaaxaalavbbbaaaaaaaaaa |
| For any comment or web-related incidence, send an email to the webmaster. |
|