|
|
|
|
|
|
|
| Information on CLUSTER HH.7.166 |
Subclass Accession number: HH-8.33.1
DB: ArchDB95
| Loops included in this Cluster |
| Loop | PDB | Chain | Start | End | Sequence | Sec Struct | Ramachandran |
| 1nr6_A_167 | 1nr6 | A | 167 | 204 | TFILGCAPCNVICSVIFHNRFDYKDEEFLKLMESLHEN | HHHHHHHHHHHHHHHHHS----TT-HHHHHHHHHHHHH | aaaaaaaaaaaaaaaaavbbbxaaxaaaaaaaaaaaaa |
| 1po5_A_168 | 1po5 | A | 168 | 205 | TLLFHSITSNIICSIVFGKRFDYKDPVFLRLLDLFFQS | HHHHHHHHHHHHHHHHHSS---TT-HHHHHHHHHHHHH | aaaaaaaaaaaaaaaaavbxxpaaxaaaaaaaaaaaaa |
| For any comment or web-related incidence, send an email to the webmaster. |
|