|
|
|
|
|
|
|
| Information on 1lpy_A_93 |
|
Loop code: 1lpy_A_93 PDB: 1lpy Chain: A Type: HH alpha-alpha |
Loop Start: 93 Loop Length: 19 Sec Struct Nt length: 5 Sec Struct Ct length: 6 Structure geometry
|
| Sequence: | AVRRAANFQGETRAGFTNSRQQKRWDEAAV |
| Sec Struct: | HHHHH---------TTTT----S-HHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| MSESELENOMETHIONINE | A - 93 | 1 | 0 |
| MSESELENOMETHIONINE | V - 94 | 1 | 0 |
| MSESELENOMETHIONINE | R - 95 | 1 | 0 |
| MSESELENOMETHIONINE | R - 96 | 0 | 1 |
| MSESELENOMETHIONINE | A - 97 | 0 | 1 |
| MSESELENOMETHIONINE | A - 98 | 0 | 1 |
| MSESELENOMETHIONINE | G - 107 | 0 | 1 |
| MSESELENOMETHIONINE | T - 109 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|