|
|
|
|
|
|
|
| Information on 1lyx_A_160 |
|
Loop code: 1lyx_A_160 PDB: 1lyx Chain: A Type: EH beta-alpha |
Loop Start: 160 Loop Length: 13 Sec Struct Nt length: 5 Sec Struct Ct length: 19 Structure geometry
|
| Sequence: | VILVYEPLWAIGTGKTATPEQAQLVHKEIRKIVKDTC |
| Sec Struct: | EEEEE--GGGTTTS----HHHHHHHHHHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| PGA2-PHOSPHOGLYCOLIC ACID | V - 163 | 0 | 1 |
| PGA2-PHOSPHOGLYCOLIC ACID | E - 165 | 0 | 1 |
| PGA2-PHOSPHOGLYCOLIC ACID | A - 169 | 0 | 1 |
| PGA2-PHOSPHOGLYCOLIC ACID | I - 170 | 0 | 1 |
| PGA2-PHOSPHOGLYCOLIC ACID | G - 171 | 0 | 1 |
| PGA2-PHOSPHOGLYCOLIC ACID | T - 172 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|