|
|
|
|
|
|
|
| Information on 1o66_E_40 |
|
Loop code: 1o66_E_40 PDB: 1o66 Chain: E Type: EH beta-alpha |
Loop Start: 40 Loop Length: 21 Sec Struct Nt length: 2 Sec Struct Ct length: 9 Structure geometry
|
| Sequence: | LVGDSLGAVQGRKSTLPVSLRDCYHTECVARG |
| Sec Struct: | EE-GGG---S--SSSTT--S---HHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| MSESELENOMETHIONINE | L - 40 | 0 | 1 |
| MSESELENOMETHIONINE | V - 41 | 0 | 1 |
| MSESELENOMETHIONINE | G - 42 | 0 | 1 |
| MSESELENOMETHIONINE | D - 43 | 0 | 1 |
| MSESELENOMETHIONINE | S - 44 | 0 | 1 |
| MSESELENOMETHIONINE | L - 45 | 0 | 1 |
| MSESELENOMETHIONINE | G - 46 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|