|
|
|
|
|
|
|
| Information on 1ogo_X_358 |
|
Loop code: 1ogo_X_358 PDB: 1ogo Chain: X Type: HA beta-beta hairpin |
Loop Start: 358 Loop Length: 16 Sec Struct Nt length: 11 Sec Struct Ct length: 9 Structure geometry
|
| Sequence: | ISSQISDYKQVGAFFFQTDGPEIYPNSVVHDVFWHV |
| Sec Struct: | EEEEEEEEEEE---STT----B--TT-EEEEEEEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| BGCBETA-D-GLUCOSE | F - 373 | 0 | 1 |
| GLCGLUCOSE | F - 373 | 0 | 1 |
| GLCGLUCOSE | Q - 374 | 0 | 1 |
| PDB Site Annotation |
| Site | Residue | atSS | atLOOP |
| AC2 - GLC BINDING SITE FOR CHAIN X | Q - 374 | 0 | 1 |
| CAT - CATALYTIC RESIDUES | D - 376 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|