|
|
|
|
|
|
|
| Information on 1frf_L_333 |
|
Loop code: 1frf_L_333 PDB: 1frf Chain: L Type: HA beta-beta hairpin |
Loop Start: 333 Loop Length: 37 Sec Struct Nt length: 3 Sec Struct Ct length: 3 Structure geometry
|
| Sequence: | YEDVKYSWYAPGGDGKHPYDGVTDPKYTKLDDKDHYSWMKAPR |
| Sec Struct: | EEE-TTBTB-TT-TTB-GGG----B----TT-SSS-BSS-EEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| MGMAGNESIUM ION | E - 334 | 0 | 1 |
| MGMAGNESIUM ION | T - 355 | 0 | 1 |
| MGMAGNESIUM ION | K - 372 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|